KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_427Help
Entry
CFPG_427          CDS       T00792                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CFPG_427
Enzymes [BR:aps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CFPG_427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(597919..598332)
Genome map
AA seq 137 aa AA seqDB search
MTTYLSLGTNLGNKELNLLKVIALIAERIGNLSAISSVYETQACGFQSANLFLNMALRVE
TSLQPVELLKASQEIERQMGRVKQHQYQDRIIDIDIILYDNIVYKSEELTIPHPLYRKRD
FVMKPLQEIIRNAMKTS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgactacctatctatcattaggaaccaacttggggaataaggaactaaatctactgaaa
gttattgcccttatagctgaaagaatagggaatctttcagctatttcatctgtctatgaa
actcaagcgtgtggatttcaatctgctaatttatttctaaatatggctctaagagtagaa
acaagtctccaacctgttgaattattgaaagcctcgcaagaaatagaaagacaaatggga
agagtaaaacaacaccaatatcaagacagaatcattgacattgatattatactgtacgac
aacattgtctataaatctgaagaactaactattcctcatcctctttacagaaaaagagac
tttgtaatgaagcctctacaagaaattatacgaaatgcaatgaagacaagttaa

DBGET integrated database retrieval system