KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_444Help
Entry
CFPG_444          CDS       T00792                                 

Definition
(GenBank) putative 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
aps00500  Starch and sucrose metabolism
aps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFPG_444
Enzymes [BR:aps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CFPG_444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77 CBM_20
Motif
Other DBs
NCBI-ProteinID: BAG83707
UniProt: B6YR85
Position
620801..623245
Genome map
AA seq 814 aa AA seqDB search
MKLRFNIHFHTSSGQKLFIIGSIHELGKWDMEQAKEMFHLGDGIWYVELNIPNEVFLLYY
RYFLKSGEGKLTFEEWKHPHYVRLNNHYKNYYIWDFWQLNPQYRVFYSSAFTKNWFARHD
EHIIVPIYKRTIRIKISAPLVAPNERVVLLGNSEALGNWIPEKALSLSCEKFPDWQIDLD
ADKLPKTFEYKFCIIDEEKKSFLRWELGENRCVNVPILEKDETFIISSLYFRDKDPEWKC
AGVVIPVFSLKTNNSFGIGDFGDLLQIIDWVRITNQKIIQILPINDTTNGHTWKDSYPYN
IISAYALHPIYLNLKAMGTLKNSERDTFYKSKQAELNKSPVVNYKEVDKWKWEFFREIFR
QDGEGVLSSCEFVSFFKENQEWLIPYANYCHIRDERDSTFSQQERYIPCHDFQLPQYKFY
YYLQFHAHKQLKKVSNYARQNKIVLKGDIPVGVHREGVETWIKPDYFNMHFQVGAPPDTF
SDEGQVWGFPVCNWKKIELDNYSWWKKRLQKMADYFDAYRIDHILGFFRIWQIPENFSNG
SLGYFSPALPLCIEEIKRWGLPFCKNTKELFIEDLDKKGYYHPRILARHTLIYKQLNQNH
QKSFDHLYNDYFYQRNNELWKLIALKHLTQIVDFTDMLVCGEDLGMIPHSVPEVMNTLQI
LSLEIERIPKSSGQEFTDLNCVPYFSVCTTSTHDMAPIRLWWKEDEKQTQHYYNRVLKKE
GTAPKDCTPKISESIICNHLNAKSMLVIIPLQDWLSIDAQLRNSNPDTERINNPTNPCHH
WQYRMHLTIEDLLEAENLNTKICSLIHRSYRTQP
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacttcggtttaatatacattttcatacatcctcgggacaaaaattatttattatt
ggatctattcatgaactggggaagtgggatatggaacaagctaaagaaatgttccacttg
ggtgatggaatatggtacgttgagttaaacatacctaacgaggtttttcttctttactac
cgttattttttaaaatctggggaaggcaagttaacttttgaagaatggaagcatcctcat
tatgtccgtcttaacaatcattacaaaaattactatatatgggatttttggcaattaaac
cctcagtatagagttttttattcatctgcatttaccaaaaattggtttgcacgtcatgat
gaacatattattgttccaatatataaaagaacgattcgtattaagatatcagctccgttg
gttgctcctaatgaacgtgtagtacttttagggaacagtgaagcgcttggaaattggatt
ccagaaaaggcattatctctttcgtgtgaaaaatttccagattggcaaattgacttagat
gcggacaagttaccaaaaacatttgaatataaattttgtatcattgatgaagagaaaaaa
agcttcctccgttgggaactaggagaaaaccgatgtgttaatgttcctattctagagaag
gatgaaacttttattatttcaagtttgtattttagggacaaagaccctgaatggaaatgt
gcaggagttgttatccctgttttttcattgaaaacaaataatagttttggaattggtgat
tttggtgatttgcttcaaataattgattgggtaagaataactaatcaaaaaatcattcaa
attctgcctatcaacgatacaacaaatgggcatacgtggaaagattcttatccttataat
ataatttctgcttatgccttgcatccgatttatctgaatttgaaagctatggggacattg
aaaaattcagaaagagatactttttacaagtccaaacaagcagaattgaataaatctccc
gtagtgaattataaggaggtagataaatggaaatgggagttttttcgtgaaatatttcga
caagatggagagggagtattgtcttcgtgtgagtttgtttccttttttaaggaaaatcaa
gagtggctgatcccttatgctaattactgtcatataagagatgaacgtgattcaactttt
tctcaacaagaaagatacattccatgtcacgactttcaattaccccaatataaattttat
tattatttgcagtttcatgcacataaacaactaaaaaaagtaagcaattatgcccgtcaa
aataaaattgtattaaaaggcgatattcctgttggtgttcatagagaaggggttgagaca
tggataaagccagattattttaatatgcattttcaggttggagctcctccagatactttt
tctgatgagggacaagtatggggttttccagtttgcaattggaaaaaaatagaacttgat
aattatagttggtggaaaaaacgcctccaaaaaatggcagattattttgatgcatatcga
atcgaccatatccttggtttttttcgtatttggcagattcctgaaaattttagtaatgga
tcactgggttattttagccccgctttgcctctctgcatagaagaaataaaaaggtgggga
ttacctttttgtaaaaacaccaaggagttattcattgaagatttggataaaaaagggtac
taccaccctcgtattcttgctcgccatactcttatttataagcaacttaatcaaaatcat
caaaaatcttttgaccatctttataatgattacttctatcaacgaaacaatgaactttgg
aagttgattgctttaaaacatttaacacaaatcgttgattttactgatatgctggtttgc
ggcgaagatttggggatgatccctcactcggtaccagaagtgatgaatacattgcaaata
ctaagtctagaaatagaacgcatacccaaatcatcgggacaagaatttactgacttaaat
tgtgttccttatttttcggtttgtacaacatctacccatgacatggctcctatccggtta
tggtggaaagaagatgaaaagcaaactcaacactattataatcgagttttgaaaaaggaa
gggactgctcccaaagactgcacccctaaaataagcgaatctatcatttgtaaccatttg
aacgcaaaatctatgttggttattattcccctacaggattggctttccatagatgctcaa
ttacgtaattcaaaccccgatacagaacggattaacaatccaactaatccttgtcatcat
tggcaatatcgtatgcaccttactattgaggatttactggaagcagaaaacttgaacact
aaaatatgtagtttaattcatcgatcgtatcgaacccaaccttaa

DBGET integrated database retrieval system