KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_460Help
Entry
CFPG_460          CDS       T00792                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CFPG_460
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CFPG_460
Enzymes [BR:aps01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CFPG_460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646998..647546
Genome map
AA seq 182 aa AA seqDB search
MDFIQKHIWGLWLIRPKLIFDERGYFMETYMKEEFERRVGTIDFVQESQSCSVCGVLRGM
HYQQGEAAQAKLINVLEGTIQDVVVDLRKDSNSFGKYETVELSAENKLQFFIPRGFAHGF
LVLSEWATINYKVDNVYCPDAERILYAGDKDVNILWDKRCELWKQSEKDRLGSSLREIEV
QL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggattttattcaaaagcatatttgggggctatggcttataaggccaaaattgattttt
gatgagagaggttattttatggaaacttatatgaaggaagagttcgaacgacgtgttgga
acaattgattttgttcaggaaagtcaatcctgttctgtttgtggtgttttgcgaggaatg
cattatcagcaaggggaagcagctcaggccaagttaataaatgtattggaaggaacaata
caagatgtagttgtggatcttcgaaaagattctaattcatttggaaaatatgaaacagta
gaattatctgctgaaaacaaactacaattttttattccgagaggttttgctcatggtttt
ttggtgttaagtgaatgggctaccattaattataaagtagataatgtttattgtcccgat
gctgaaagaatattgtatgccggggataaagatgtgaatattttatgggacaaaagatgt
gaattgtggaaacaatctgaaaaagatcgattaggtagttcgttaagagaaatcgaagtg
caattatga

  All links  
No link information was found.   
DBGET integrated database retrieval system