KEGG   Candidatus Azobacteroides pseudotrichonymphae: CFPG_485Help
Entry
CFPG_485          CDS       T00792                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aps00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aps00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691638..692546
Genome map
AA seq 302 aa AA seqDB search
MKKKDFVSITDCSKQDILHLIERSAYFERNLNQLLLKDKICATLFFEPSTRTRLSFETAI
NRLNGRIIGFSDVHTTSSSKGETLKDTIKIVSNYADVIIMRHYLEGAARYASKITDVPIV
NAGDGANQHPSQTLLDIYSMYKTQGTLYNLTITIVGDLKYGRTVHSLLNGMSYFNPTFHF
IAPEELKLPIIYKQFMDENSIQYFDHSDFLVDIINQSDILYMTRVQRERFNDLIEYEKVK
NVYVLSNDMLADSKDNLRILHPLPRVGEITSDVDTNPKAYYFEQARNGIFARQAIICDVL
GL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaggattttgtatctattaccgattgttccaaacaagatattttgcatttg
attgaacggtcggcatattttgaacgaaatctaaatcagcttttattaaaggataaaatc
tgtgctacgcttttttttgagccatctacacgcacccgtttgagttttgagacagctatt
aatcgtttgaatggtcggattattgggttttctgatgttcatactacgagtagctctaag
ggagaaaccttaaaagataccattaaaatagtgagtaattatgctgatgttattattatg
agacattatttagaaggagcagctcgttacgcttctaaaataacagatgtgccgattgtc
aatgctggcgatggagccaatcaacatccttcgcagactttattggatatttattctatg
tacaaaacacaaggaacactttacaacctgactattactatagtgggcgatttgaaatat
ggtcgaactgttcattctcttcttaatggtatgtcttattttaatcctacttttcatttt
attgctcctgaagaattgaagttaccgattatttataagcagtttatggatgaaaacagt
attcaatatttcgatcactcggattttttggtagatataatcaatcaatctgatatactc
tatatgactcgtgtacaacgagaacgttttaatgatttgattgaatacgagaaggtgaaa
aatgtgtatgttctttctaatgatatgctcgctgatagtaaagataatcttcgaatattg
catcctttacctcgtgtaggagagattacttctgatgtggatactaatcccaaggcgtac
tattttgaacaagctagaaacggtatttttgctcggcaggcaattatatgtgatgtgtta
ggtttataa

DBGET integrated database retrieval system