KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_514Help
Entry
CFPG_514          CDS       T00792                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFPG_514
   00051 Fructose and mannose metabolism
    CFPG_514
Enzymes [BR:aps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CFPG_514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
737756..739081
Genome map
AA seq 441 aa AA seqDB search
MNTSNNRGFFAGIEKIQFEGLESKNPLAFRWYDENRVVLGKTMKEWLRFSMAYWHTLCAE
GADQFGGGTKKFPWNKGSDAISRAKNKMDAAFEFMTKIGVPFYCFHDVDLVEEGNSFAEY
ENNLAKIVEYAKEKQTSTGVKLLWGTANVFSNRRYMNGAATNPDFGVVAWAGAQIKNAID
ATIALGGMNYVFWGGREGYMSLLNTDMKREKEHLAQMLIMTRDYARKKGFKGTFLIEPKP
MEPSKHQYDVDAETVIGFLRHYKLDKDFKINIEVNHATLAGHTFEHELQVAVDAGMLGSI
DANRGDYQNGWDTDQFPVDIYELIQALLVVIEGGGFGNGGTNFDAKTRRNSTDLEDIFIA
HISGMDIFARALVSAAAILEKSDYRKLRADRYISFNSGDGKFFENGELTLEDLRNITAKN
GEPIQISGKQELYEAIVNMYI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatcgaataatagaggattttttgcaggaatagaaaaaatccagtttgaagga
ttagaaagtaaaaatccattagcttttcgttggtacgacgaaaatagagttgtattagga
aaaaccatgaaagaatggttgaggttttctatggcttattggcatactttgtgtgctgaa
ggtgctgatcaatttggaggaggaactaaaaaattcccatggaataaaggctcggacgcc
attagtcgtgctaagaataagatggatgcagcatttgagtttatgactaagataggagtt
ccattctattgcttccatgatgtagatttggtggaagaaggtaattcttttgcagaatac
gaaaacaatttagctaaaattgtagagtatgctaaggaaaaacaaacttctacaggtgtc
aaattactttggggtacagcaaacgtttttagtaatcggcgttatatgaatggtgctgct
actaatcctgattttggtgttgttgcttgggcaggtgctcagatcaaaaatgctattgat
gcgacaattgctttaggaggcatgaactatgtattttggggtggtcgtgaaggatatatg
agtttgttgaatacagatatgaaacgtgaaaaagaacatttagcacaaatgctgattatg
actcgtgattatgcacgtaaaaaaggttttaaagggactttccttattgaaccaaaaccg
atggaaccttctaagcatcaatatgatgtggatgcagaaactgttattggttttttgcgt
cactataaattggataaggattttaaaataaatattgaagtaaatcatgcaactttggcg
ggtcacacttttgaacatgaattgcaagtagctgttgatgctggtatgttgggttctatc
gatgccaatcgtggtgattatcagaatgggtgggatactgatcaatttcctgttgatatt
tatgaattgatacaagcccttttggttgtcattgaaggaggtggttttggcaatggaggt
acgaattttgatgcaaaaactcgtcgtaactcgactgatttggaagatatctttattgct
catatttctggtatggatatttttgctcgtgctttagtttcggctgcagccatacttgaa
aaatcagattacagaaaactacgtgctgatcgttatatttcttttaattccggagatggg
aaattttttgaaaatggggaattgacacttgaagacttgcgtaatattacggctaaaaat
ggtgagcctattcaaattagtggtaaacaagagttgtatgaagcaatagtaaatatgtat
atataa

DBGET integrated database retrieval system