KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_569Help
Entry
CFPG_569          CDS       T00792                                 

Definition
ribosomal large subunit pseudouridine synthase B
Orthology
K06178  
23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Brite
Enzymes [BR:aps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     CFPG_569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
822431..823303
Genome map
AA seq 290 aa AA seqDB search
MLKKNDTRDHLGKEKYGNKWNYNNQGKSDCNLNSKYNFQKKIKYYKVEPNSNGPIRLNRY
LANSGLCSRRKADKYIQTGLVKKNGIPVTEFGTRVNRTDNITFCNSLVRSEHKVYLLLNK
PKNCVTTTNDPQGRLTVMDLIKTACKEQIFPVGRLDRNTTGVLLLTNDGKLSAKLTHPRH
MKKKIYHVWLNRGIDAADIKKLSKGIQLEDGGIWADDISYVNDKDKTQINIEIHSGRNHI
IRRMFESLGYHVVKLDRVYFAGLTKKKLKKGQWCFLNDREVSMLYMEKFS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagaaaaatgatactcgagatcatttgggaaaagaaaaatatggtaataagtgg
aattataataaccaaggtaaaagtgattgcaatcttaattcaaaatataattttcaaaaa
aaaataaaatactataaagtagaacctaattcaaacggtccaattcgcttaaacaggtat
ttagctaactcaggactttgttctcgtcgtaaagcagataaatatattcaaactggttta
gtaaaaaaaaatggaatacctgttactgaatttggaacaagagtaaatcgtacagataat
ataacattttgtaattctcttgttcgttccgaacataaagtttaccttttgctgaataaa
cctaaaaattgtgtgacaactactaatgatccgcaaggaagacttacagttatggatttg
atcaaaacagcatgcaaagaacaaatttttcccgtaggaaggctagatcgaaacacaaca
ggtgttttattactgactaatgatggtaaattatcagcaaaattgactcatcccagacat
atgaaaaaaaaaatctatcatgtatggctaaatagaggaatagacgcagctgatataaaa
aaactatctaaaggtattcaattagaagatggtgggatttgggccgatgatattagttat
gtaaatgacaaagataagacccaaataaatattgaaattcactcgggacgcaatcatatt
attcgtcgtatgtttgaaagtttaggttaccatgtggtgaaattagatcgtgtttatttt
gctggacttacaaaaaaaaaactaaaaaaaggtcaatggtgttttcttaatgatagagaa
gtttccatgctttacatggaaaaattcagttaa

DBGET integrated database retrieval system