KEGG   Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus): CFPG_659Help
Entry
CFPG_659          CDS       T00792                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aps  Candidatus Azobacteroides pseudotrichonymphae (Coptotermes formosanus)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CFPG_659
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFPG_659
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CFPG_659
Enzymes [BR:aps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CFPG_659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
953603..954916
Genome map
AA seq 437 aa AA seqDB search
MKYYSTNKQAPLASLQQAVIKGLAEDKGLYMPENITALDSHIISSMKNMNLQQIGNIIAQ
SFFGDSIEADVLNNIVNETLQFDIPLINLHDNIYSLELFHGPTLAFKDVGARFMARLLKY
FIKKKGIKDINVLVATSGDTGSAVANGFFGVKGINVYILYPKKKVSDIQEYQFTTLGENI
FALEINGTFDDCQTLVKSAFMDKELNSKKCLTSANSINIARFLPQSFYYFYAYAQLDKIN
KAKKLVVSVPCGNLGNLCAGLVAHKMGLPIEHFIAANNKNNVFSNYLKTGVFIPKPSVST
YANAMDVGNPSNFERITDLFSIYSSPYQAITKQISGHSYNDTRVAKTMQHVYGTYNYILD
PHGAIAYQALIEDESLKIDKSGVFLETAHPAKFKNIVDDILGIDINVPDALQTFMRGKKQ
SIELEKDFTEFKNYLLH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatagcacgaataaacaagctcctcttgcttcactgcagcaagcagtaata
aaaggattagcagaagacaaaggattatatatgccagaaaatattactgcgttagatagt
catataataagcagtatgaaaaatatgaacctccaacaaatagggaatataatagcacag
tcttttttcggcgatagcatagaagctgacgttttgaacaacattgtaaatgaaacactt
caattcgatatacctctcataaatctacatgacaatatatatagccttgagctttttcat
ggacctacactagcattcaaagatgtaggtgccaggttcatggcacgtttactcaaatac
tttatcaaaaaaaaaggaataaaagatataaatgtattagttgctacatcgggagataca
gggagcgccgtagcaaacggattttttggtgtaaaaggtattaacgtatatatcctctat
cctaaaaaaaaagtaagtgatatacaagaatatcaatttactacactaggggaaaatatt
tttgcattagaaataaacgggacttttgatgactgccaaacacttgtaaaaagtgctttt
atggataaagaactaaactcaaagaaatgtttaacatctgcgaattctatcaatatagca
cgctttcttccccaatctttttattatttttatgcttatgctcaattagacaaaataaat
aaagcaaagaaactagtagttagtgttccttgtggaaatttagggaacctttgtgccggg
ctagtagcccataaaatggggctacctattgaacatttcattgccgctaataataaaaat
aatgtattttccaactatctaaaaacaggtgtatttattccaaaaccatctgttagtacc
tatgctaatgccatggatgtaggaaatccaagtaattttgaacgtattacagatttattt
agcatctattctagcccttatcaagctattactaaacaaatttctggacatagttacaat
gatacacgtgttgccaaaacaatgcaacatgtgtatggtacatataactatatacttgat
ccacacggagctattgcttatcaagctttaatagaagatgaatctctcaagatcgacaaa
agtggtgtttttttagaaactgcacatccagccaaatttaaaaacattgtagatgatata
ctaggaattgatataaatgttcctgatgcattacaaaccttcatgaggggtaaaaaacaa
agtattgaattagaaaaagatttcactgagtttaaaaactatctcttacattaa

DBGET integrated database retrieval system