KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_04030Help
Entry
APA01_04030       CDS       T00988                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00900  Terpenoid backbone biosynthesis
apt01100  Metabolic pathways
apt01110  Biosynthesis of secondary metabolites
apt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APA01_04030
Enzymes [BR:apt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     APA01_04030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: BAH98554
UniProt: C7JCV1
Position
421510..422415
Genome map
AA seq 301 aa AA seqDB search
MTVDVLDVATTTLTEIAPAKINLYLHVTGRRPDGYHLLDSLVVFAGAGDVLHYEPGTEPL
HLKLEGRFGRALGADAAGADNLVMKAAAVLRDLAGPQANVQGGCLVLEKNLPVASGIGGG
SADAAAALRLLNRAWNAQVDEPTLFRVAETLGADVPVCLLSQTVRMEGIGETLTPAPRLP
ECGLVLVNCGQAVSTPDVFRKRTGDFVPRADLPQSWPNSAAMVATLKAQENSLETPACTV
CPPVKKVLADIAAQPDCQLARMSGSGATCFGVFPTVEAAREAADRLAEAHAAWWVWGGAL
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgatgttctggatgttgcaaccacaaccctgacagaaatcgcaccagcaaaa
atcaatctgtatttgcacgttactggccgccgcccagatggataccatctgcttgatagc
cttgtggtgtttgccggtgcaggagatgtgctgcattacgaaccgggtacagaaccgctg
caccttaagctggaaggccgctttggccgcgcccttggtgctgatgccgcaggtgccgat
aatctggtaatgaaagccgccgccgtgctgcgtgatctggccgggccgcaggccaatgtg
cagggtggttgccttgtgctggaaaaaaacctgcccgtggcttctggcattggcggaggt
tcggcagatgccgctgcggctctacgcctgctaaaccgggcatggaatgcacaggtggat
gaacccaccttgttccgcgtggcggaaacactgggggccgatgtgcccgtgtgcctgctg
agccaaaccgtgcggatggaaggtattggggaaacccttacccccgcaccgcgtttgcca
gaatgtggccttgtgctggtgaattgcgggcaggctgtttccaccccggatgtgttccgc
aaaagaacgggcgattttgtgccgcgggcggatttaccgcaaagctggcccaatagtgcc
gccatggtggcaacccttaaggcgcaggaaaacagcctggaaaccccggcatgcaccgta
tgcccgccggttaaaaaggtgttggctgatattgcggcccagccagattgtcagttggcc
cgtatgagcggctctggtgccacatgctttggcgtgttccccactgttgaagccgcgcgg
gaggcagcagacaggttggcagaggcacacgccgcatggtgggtgtggggcggggctctg
gtttaa

DBGET integrated database retrieval system