KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_06540Help
Entry
APA01_06540       CDS       T00988                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
apt00900  Terpenoid backbone biosynthesis
apt01100  Metabolic pathways
apt01110  Biosynthesis of secondary metabolites
apt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APA01_06540
Enzymes [BR:apt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     APA01_06540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Sacchrp_dh_NADP NmrA Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAH98803
UniProt: C7JE09
Position
678506..679729
Genome map
AA seq 407 aa AA seqDB search
MVWPPVERSAAVCIFRFGKTLSMRTVTVLGSTGSIGCSTVDLLEQARDQFRVRALVGGKN
AAKLAEQARSLKAELAVLADESAFEELKTLLAGSGTEVACGRQAVIDAAALPADWTMAAI
TGAAGLEPTLAAVKNGKSIALANKEALVCAGDVMLRAVKEAGATLLPVDSEHNAVFQAMA
DRQIDQVEKIILTASGGPFRTSTLEEMRVATRAQALKHPTWSMGAKISIDSASMFNKGLE
VIEAARIFNLPENKIDVLVHPQSVVHGMAQYTDGSLIAQMGSADMRIPIAHTLTWPKRMA
TTSPRLDLAAFGKLEFYAPDEVRFPALRLAREALRKGGAASAILSAANEIAVDAFLHEQI
GFLDISRIVEEVMVALGAPPADTLDAVLHWDAEARRAAQRLIPAHAA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtggccgcctgttgagcggtctgccgccgtttgtattttcaggtttggaaagacg
ttaagcatgagaaccgtaaccgttctgggcagcacaggcagcattggctgttcaaccgta
gatctgctggagcaggcgcgagaccagtttcgggtacgggcgcttgtggggggcaaaaat
gctgccaaattggcagagcaggcccgcagcttaaaggcagagctggccgttctggcggat
gaaagcgcgtttgaggaactgaaaaccctgctggcaggcagcggcacggaagtagcctgt
ggccgtcaggcggttattgatgccgcagcccttccggcagattggacaatggccgccatt
acgggtgctgcggggctggagcctacgctggcagcggttaaaaacggcaaaagcattgcg
ctggccaacaaggaagccttggtgtgcgccggtgatgtgatgctacgtgccgtaaaggaa
gcgggtgccacgctgctgccggtggattctgagcacaacgctgtttttcaggctatggcc
gatcggcagattgatcaggttgaaaaaattattctcacagcatcgggtgggccgttccgc
acctccacgctggaagaaatgcgcgtagccacccgtgcgcaggcgctcaagcacccaaca
tggagcatgggggccaaaatcagcatcgattctgccagcatgttcaacaaggggctggaa
gttattgaggccgcccgtatttttaacctgccggaaaacaagattgatgtgctggtgcat
ccgcaatctgttgtgcacggcatggcgcagtacacagatggcagcctgattgcccagatg
ggctctgccgatatgcgtatccccattgcccacacactcacatggcccaagcgtatggcc
accacgtctccgcgtttggatctggcagcttttggcaagctggaattctatgcgccggat
gaagtacgctttcccgcgctgcgccttgcgcgtgaggccctgcgtaaggggggggcagca
tctgccatcctttccgctgccaatgaaattgcggttgatgccttcctgcatgaacagatc
ggctttttggacatttctcgcattgtggaagaggtgatggtggcccttggcgcaccgcca
gcagatacgctggatgccgtgctgcattgggatgccgaggcacgccgtgccgcacagcgc
ctgattcccgcccacgcggcttga

DBGET integrated database retrieval system