KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_07080Help
Entry
APA01_07080       CDS       T00988                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APA01_07080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA01_07080
   00620 Pyruvate metabolism
    APA01_07080
   00640 Propanoate metabolism
    APA01_07080
  Energy metabolism
   00680 Methane metabolism
    APA01_07080
Enzymes [BR:apt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     APA01_07080
Lipid biosynthesis proteins [BR:apt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   APA01_07080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
733137..735059
Genome map
AA seq 640 aa AA seqDB search
MVDAFFPATDNPVSDRYQDLVQRAQRDPEEFWLAQAQRLAWHTQPMHASRSDFTGDVRVS
WYEDGRLNAAENCLDRHVLYQPDNAALIWQGQEDGHREVLSYRELHARVCRLGNVLRRLG
VKKGDRVAIHLPMVAEGVISMLACARIGAVHVVLFGGFSAEGLAERLTDSGAVVVITADV
ARRGPKKIPSKTTMDEAIKLCGAQSAVRNVLVVPVTGADVPMQKGRDLSYTAEVALEIPD
CPPEVMNACDPLFLLYTSGSTGRPKGLVHSTGGYLVWASFTQELVFDAKPSDVFWCTADT
SWITGHTYVVYGPLVNGGTILVYEGLPSWPQPGRWWDVIDQNQVSVFYTSPTVIRAAMRE
DDSVVQSRSLSSLRVLGTVGEPISPEAWKWFYAEVGRNACPVVDTWWQTETGGVMITACA
QNVAAKPGAAGLPLPGVAATLTDTKGQDIEGEGEGLLCLAQSWPGQAMTLWQDHERFRKT
YFTTCPGHYFSGDGARRDATGYYWITGRVDDVVNVSGHRIGTAEIEDAVAEDHAVVESAA
VGVPHDLKGQALVVFVVPKAEGAFDATAVNKAVAAGVGRYAVPEKIYVVPDLPKTRSGKI
VRRLLRKIAANDLENMGDLSTLADPDIVAELIKLVAQQNG
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
gtggtagatgcgtttttccccgcaacggataaccccgtttctgatcggtatcaggatctt
gtgcagcgggcgcaacgtgatccggaggaattctggctggctcaggcgcaaaggctggca
tggcatacgcaacccatgcacgcatctcgctctgactttaccggcgatgtgcgggtttcc
tggtatgaagacgggcggctgaatgcggctgaaaactgtctggaccggcacgttctgtat
cagcccgataatgctgccctgatctggcaggggcaggaagacggccaccgcgaggtgctc
tcataccgtgaactgcatgcccgcgtctgccgcttgggcaatgtgctgcgccgtttgggt
gtaaaaaagggagaccgcgtggccatccatctgcccatggtggcagagggtgttatttcc
atgctggcctgcgcccgtattggggccgtgcacgtggtgctgtttggtggtttttctgcc
gagggtctggcagaacgtttgacagatagcggcgctgtggtggtgattaccgcagatgtg
gcgcgccgcgggcccaagaaaattcccagcaagaccacaatggatgaggccataaaattg
tgcggggcacaaagtgccgtgcgcaatgtgctggtggtgcctgtaacgggtgctgatgtg
cccatgcaaaaggggcgggacctgtcctacacagcagaagtagcgcttgaaataccggat
tgcccgccagaagtgatgaacgcgtgtgatccgctgtttctgctttacacatccggcagc
acgggccgccccaaagggctggtgcacagcacgggcgggtatctggtgtgggcgtctttc
acacaggagctggtgtttgatgccaaacccagtgatgtgttctggtgtacggcagataca
agctggattaccggccacacctatgttgtgtacgggccgctggtaaatggtggcaccatt
cttgtgtatgaaggcctgccatcatggccacagcccggccgctggtgggatgtgatagac
cagaaccaggtttcggttttctatacgtctcccacagttattcgcgctgccatgcgtgag
gatgattccgtggtgcaaagccgctctctgtccagcctgcgtgtgctgggtacggtgggt
gagcctatcagcccggaagcatggaagtggttttatgcagaagtagggcgcaatgcctgc
ccggtggtggacacatggtggcagacagaaaccggcggtgtgatgattaccgcctgcgcc
cagaatgttgctgctaagccgggagccgcagggctgcctttgccgggtgtggccgctacg
ctgacagataccaaagggcaggatattgaaggcgagggcgaaggcctgttgtgccttgcg
caatcctggcccggacaggccatgacgctgtggcaggaccacgaacggtttcgcaaaacc
tatttcaccacatgcccgggccattatttctcgggtgatggcgcacgacgggatgccacc
ggttattactggattaccggccgcgtggatgatgtggtgaacgtatctggccaccgcatt
ggcacggcagaaattgaagatgccgtggccgaagatcatgccgtggtggaaagtgccgcc
gttggcgtgccgcatgatctgaaagggcaggcccttgtggtgtttgtggtgcccaaggcg
gagggcgcgtttgatgccacagccgtaaacaaggccgtggccgcaggcgtgggccgctat
gcggtgccagaaaaaatttacgtggtgccggatctgcccaaaacacgttcgggcaaaatt
gtgcggcgtttgctgcgcaaaattgcggcgaatgatctggaaaatatgggggatctgtcc
actctagcagacccggatattgtggctgaactgataaagctggtggctcagcagaacggc
tga

DBGET integrated database retrieval system