KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_07980Help
Entry
APA01_07980       CDS       T00988                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APA01_07980
Enzymes [BR:apt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     APA01_07980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834340..835068
Genome map
AA seq 242 aa AA seqDB search
MHPRGVIVTRPEPGLSETMAAVADTGWLPLASPALVVQRHTLRLPQKLPAAILLTSGQAV
SAAVVAAQQAKALDIPVYAVGDRTAQRARDAGFTHVKSADGDARALVALLQTHQQPECGS
LLLCSGAGQGVELAAWCRQAGFKVVRRVVYAAKPIQHINAQTCTAIQAAKVAVVLFFSAE
SAAGWLAALPEAEQKQLAAQASAVVISGRVAGVLRAAGWQNIRVADHVSAAAVMDALGTY
PA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgcgcggcgtgattgtcacgcgcccggaaccggggctgagtgaaacaatggca
gccgttgcagatacaggctggctgccattggcctcacctgcattggttgtgcagcggcat
acgttgcgcctgccgcaaaaattacccgcagccatattacttaccagtgggcaagctgtt
tctgctgcggttgtagcggcacagcaggccaaagcgctagatataccggtttatgcggta
ggggatcgcacagcccaacgggcgcgagatgccgggtttacgcacgttaaaagtgcggat
ggtgatgcccgtgcgcttgttgcgcttttacaaacccaccaacagccagaatgtggcagc
ctgttgctatgctctggggcagggcaaggcgtagagcttgcggcttggtgcaggcaggcg
gggtttaaggttgtgcgccgggttgtttatgcagccaaaccgatccagcatataaacgct
caaacatgcacagccattcaggctgccaaggtggcggtggttctgtttttttcagcagag
agtgccgctggctggttggccgctttgcctgaggcagaacagaagcagttagctgcgcag
gcaagtgcggtggtgatatctggccgtgtagccggtgtgctgcgtgcggccggttggcag
aacatacgtgttgcagaccatgtatccgccgcagcggttatggatgctttggggacgtat
cccgcataa

DBGET integrated database retrieval system