KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_11890Help
Entry
APA01_11890       CDS       T00988                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:apt00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:apt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1247241..1247759
Genome map
AA seq 172 aa AA seqDB search
MDGRFLNRIAVSAVLSAAVLATCVFAARSTVPDTAPARPAFSLPGLEPVPIAPLMAQANV
QRGGATVRQVCAQCHALAGGAAENAGPPLAGVAGRGVASCTGYTYSAALRQHAGQHWTDQ
MLADWLMAPARFAPGTRMSLTGIPDPAQRADVIAFLHTLGGQAAPAQAGCTP
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggatggcaggtttctgaacagaatagcggtttccgccgtgcttagtgcggcagtgctg
gcaacatgtgtgtttgctgcacgcagcaccgtgccagatacagcccctgcccgccctgct
ttttctttgccggggttggagcccgtacctattgctccgttaatggcgcaggccaatgtg
cagcgtggtggtgcaaccgtcaggcaggtttgcgcgcagtgccacgccttggctggtggg
gccgcggaaaacgccgggccgccgctagccggtgttgctgggcgtggtgtggcatcatgc
actggctacacctattctgcggcgttacggcagcatgcaggccagcattggacagaccag
atgctagcggattggcttatggcccctgcccgctttgcacccggcacacgtatgtctctc
actggtataccagatcccgcccaacgggcggatgttattgcatttcttcacactctcggc
gggcaggctgcgcccgcacaggcaggatgcacaccatga

DBGET integrated database retrieval system