KEGG   Acetobacter pasteurianus IFO 3283-01: APA01_16240Help
Entry
APA01_16240       CDS       T00988                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
apt  Acetobacter pasteurianus IFO 3283-01
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:apt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    APA01_16240
  Metabolism of other amino acids
   00480 Glutathione metabolism
    APA01_16240
Enzymes [BR:apt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     APA01_16240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1758092..1758580
Genome map
AA seq 162 aa AA seqDB search
MNLTCIYDFKLPALNGSTLDLSAYRGKPVLVVNTASKCGFTPQYEGLQALWTQFQKAGLV
VVGVPSNDFGQQEPGTSEEISSFCQINYGVTFPMAARSPVKGPDAIPLFKWLDSELGFLA
RPRWNFFKYLTNRQGMPVAWFSSLTPPTSGRVRHAVEKALKS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgacctgtatatatgattttaaactccccgccctaaatggaagcacccttgat
ctgagcgcttatcgggggaaacctgttctggtggtgaacaccgcatctaaatgcggattt
accccgcaatatgaaggcttgcaggctttgtggacacagttccaaaaagccgggctggtt
gttgtgggggtgccaagcaatgattttggccagcaggaacccggcacttcggaagagatt
tcctccttctgccagatcaattacggggttaccttccctatggcggcacgcagccctgta
aaagggccagatgctattcctctctttaaatggctggatagtgagcttgggtttctggct
cggccacggtggaacttctttaagtatctcaccaaccgtcagggtatgccagttgcatgg
tttagcagcctaacaccgcctacatccgggcgtgtcaggcatgctgtggaaaaggctctc
aaatcgtaa

DBGET integrated database retrieval system