KEGG   Acetobacter pasteurianus IFO 3283-07: APA07_00250Help
Entry
APA07_00250       CDS       T01813                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apu  Acetobacter pasteurianus IFO 3283-07
Pathway
apu00010  Glycolysis / Gluconeogenesis
apu00071  Fatty acid degradation
apu00350  Tyrosine metabolism
apu00625  Chloroalkane and chloroalkene degradation
apu00626  Naphthalene degradation
apu01100  Metabolic pathways
apu01110  Biosynthesis of secondary metabolites
apu01120  Microbial metabolism in diverse environments
apu01130  Biosynthesis of antibiotics
apu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA07_00250
  Lipid metabolism
   00071 Fatty acid degradation
    APA07_00250
  Amino acid metabolism
   00350 Tyrosine metabolism
    APA07_00250
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APA07_00250
   00626 Naphthalene degradation
    APA07_00250
Enzymes [BR:apu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APA07_00250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N TrkA_N adh_short AlaDh_PNT_C 2-Hacid_dh_C 3HCDH_N ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: BAI04281
Position
complement(23076..24104)
Genome map
AA seq 342 aa AA seqDB search
MSGKMKAAVVHEFGKPLTIEELDIPPIKPTQILVKMIACGVCHTDLHAASGDWPKKPHLP
FIPGHEGVGTVVQVGSEVDWVKEGDVVGVPWLYSACGHCEHCLAGWETLCAKQEETGYSV
NGCFAEYVVADPNYIAHLPKGVDPVKVAPVLCAGLTVYKGLKMTDTRAGNWVAISGVGGL
GQMAVQYAVAMGLNVVAVDIDDEKLATAKKLGATYTVNARNTDPAAFMQEKVGGVHGGLI
TAVSTKAFSQAMGYVRAGGTLVLNGLPPGDFPISIFDMVMNAITIRGSIVGTRLDMIEAL
SFFAEGKVTSVTTTDRIDNINAIFDALKNGRVEGRVVLDFRN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaaaaatgaaagccgctgtggttcatgaatttggcaaaccactgaccattgaa
gaactggacattccccccattaaacctacccagattttggttaaaatgattgcctgcggc
gtgtgccatacagatttgcatgctgccagcggggattggcccaaaaaaccacatctgccg
tttatccccggccacgaaggcgttggcacggttgtgcaggttggcagcgaagtagattgg
gtaaaggaaggcgatgttgttggcgtgccttggctctattctgcctgtggccattgcgag
cattgtctggctgggtgggaaaccctttgcgcgaagcaggaagaaactggctattccgta
aacggctgctttgccgaatacgtggtagcagaccctaactacattgctcatcttcccaaa
ggcgtagaccccgtaaaagttgctcccgtactgtgcgcaggcctgaccgtttataaaggc
ctgaaaatgacagacacgcgggcagggaactgggttgccatttccggcgttggggggtta
ggccagatggctgtgcagtacgccgtagcaatggggctgaatgttgtggcggtagatatt
gatgatgaaaaactggcaaccgccaaaaagcttggtgcaacgtacactgttaacgccaga
aatacagatccggcagcatttatgcaggaaaaagttggtggcgtacacggtggattgatc
accgctgtttccaccaaagcattttctcaggctatgggttatgtgcgggcagggggcact
ttggtgctaaatgggctgccgccgggtgatttcccaatttctatctttgacatggtcatg
aatgccattaccattcgcggctccatagtaggcacacggctggacatgattgaagctctt
tccttctttgcggaaggaaaggtaacatctgtcaccacaacggatcggattgataacatc
aacgcaatttttgatgcgctcaagaacggtcgggtggaaggccgcgtggttctggacttc
cgcaactga

DBGET integrated database retrieval system