KEGG   Acetobacter pasteurianus IFO 3283-07: APA07_03120Help
Entry
APA07_03120       CDS       T01813                                 

Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
apu  Acetobacter pasteurianus IFO 3283-07
Pathway
apu00260  Glycine, serine and threonine metabolism
apu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apu01100  Metabolic pathways
apu01110  Biosynthesis of secondary metabolites
apu01130  Biosynthesis of antibiotics
apu01230  Biosynthesis of amino acids
Module
apu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APA07_03120
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APA07_03120
Enzymes [BR:apu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APA07_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: BAI04563
Position
324884..325717
Genome map
AA seq 277 aa AA seqDB search
MSRIAARFKALAAQGRGALIPYLEAYDPDWDTSLELLRKMPAAGADLIEIGMPFSDPSAD
GPVIQAAARRGLKAGATLAGVLDMVTDFRQQDNETPIILMGYLNPVESYGYERFCRDAAS
AGVDGLILVDLPPEEADVLAPFAKANKLDIIRLVAPTTSDERLPYVLSHASGFVYYVSIT
GITGTRSATTHDLEAAIPRLRKVTKLPIAIGFGVRTPQQAANASSIADGAVVASALLSTL
AETLDDKGRATAETLPRVLAQIEDLAKAVRSANGKAV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtatagcagcccgttttaaagcacttgcggcccaaggccgcggcgcgcttatt
ccgtatctggaagcatatgatccggattgggatacatcgctcgaactgctacgcaaaatg
cccgctgctggcgcagatctgattgaaattggcatgcctttttcagatccctccgccgat
ggcccggttattcaggctgctgcccgccgtggccttaaagccggggccacgctggcaggt
gtgctggatatggtcacggacttccgccagcaggataacgaaacccccattatccttatg
ggctatctaaatccggtagaatcctatgggtatgaacgcttctgccgtgatgccgccagc
gctggtgtggacgggctgattctggtggatctgccgccagaggaagccgatgtgctggca
ccatttgccaaggccaacaagctggatatcatccggcttgtggcgcctaccacgtcggat
gaacgcctgccttatgtgctctctcacgcatctggctttgtgtattatgtcagcattacg
ggcattacgggcacacgttctgccactacgcatgatctggaagccgctattccacgtctg
cgtaaggttaccaaattgccgattgctattgggtttggtgtgcgtacgccgcaacaggcc
gccaatgcttccagcattgccgatggtgcagtcgtggcttcggccctgctttctactttg
gcggaaacgctggatgacaaaggccgcgctacggcagaaacgcttccgcgcgtgttggcg
cagattgaagatctggcaaaagccgtgcgtagcgctaacggaaaggcggtatga

DBGET integrated database retrieval system