KEGG   Acetobacter pasteurianus IFO 3283-07: APA07_04030Help
Entry
APA07_04030       CDS       T01813                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
apu  Acetobacter pasteurianus IFO 3283-07
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:apu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
421504..422409
Genome map
AA seq 301 aa AA seqDB search
MTVDVLDVATTTLTEIAPAKINLYLHVTGRRPDGYHLLDSLVVFAGAGDVLHYEPGTEPL
HLKLEGRFGRALGADAAGADNLVMKAAAVLRDLAGPQANVQGGCLVLEKNLPVASGIGGG
SADAAAALRLLNRAWNAQVDEPTLFRVAETLGADVPVCLLSQTVRMEGIGETLTPAPRLP
ECGLVLVNCGQAVSTPDVFRKRTGDFVPRADLPQSWPNSAAMVATLKAQENSLETPACTV
CPPVKKVLADIAAQPDCQLARMSGSGATCFGVFPTVEAAREAADRLAEAHAAWWVWGGAL
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgatgttctggatgttgcaaccacaaccctgacagaaatcgcaccagcaaaa
atcaatctgtatttgcacgttactggccgccgcccagatggataccatctgcttgatagc
cttgtggtgtttgccggtgcaggagatgtgctgcattacgaaccgggtacagaaccgctg
caccttaagctggaaggccgctttggccgcgcccttggtgctgatgccgcaggtgccgat
aatctggtaatgaaagccgccgccgtgctgcgtgatctggccgggccgcaggccaatgtg
cagggtggttgccttgtgctggaaaaaaacctgcccgtggcttctggcattggcggaggt
tcggcagatgccgctgcggctctacgcctgctaaaccgggcatggaatgcacaggtggat
gaacccaccttgttccgcgtggcggaaacactgggggccgatgtgcccgtgtgcctgctg
agccaaaccgtgcggatggaaggtattggggaaacccttacccccgcaccgcgtttgcca
gaatgtggccttgtgctggtgaattgcgggcaggctgtttccaccccggatgtgttccgc
aaaagaacgggcgattttgtgccgcgggcggatttaccgcaaagctggcccaatagtgcc
gccatggtggcaacccttaaggcgcaggaaaacagcctggaaaccccggcatgcaccgta
tgcccgccggttaaaaaggtgttggctgatattgcggcccagccagattgtcagttggcc
cgtatgagcggctctggtgccacatgctttggcgtgttccccactgttgaagccgcgcgg
gaggcagcagacaggttggcagaggcacacgccgcatggtgggtgtggggcggggctctg
gtttaa

DBGET integrated database retrieval system