KEGG   Acetobacter pasteurianus IFO 3283-07: APA07_07080Help
Entry
APA07_07080       CDS       T01813                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apu  Acetobacter pasteurianus IFO 3283-07
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:apu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:apu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:apu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:apu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
733131..735053
Genome map
AA seq 640 aa AA seqDB search
MVDAFFPATDNPVSDRYQDLVQRAQRDPEEFWLAQAQRLAWHTQPMHASRSDFTGDVRVS
WYEDGRLNAAENCLDRHVLYQPDNAALIWQGQEDGHREVLSYRELHARVCRLGNVLRRLG
VKKGDRVAIHLPMVAEGVISMLACARIGAVHVVLFGGFSAEGLAERLTDSGAVVVITADV
ARRGPKKIPSKTTMDEAIKLCGAQSAVRNVLVVPVTGADVPMQKGRDLSYTAEVALEIPD
CPPEVMNACDPLFLLYTSGSTGRPKGLVHSTGGYLVWASFTQELVFDAKPSDVFWCTADT
SWITGHTYVVYGPLVNGGTILVYEGLPSWPQPGRWWDVIDQNQVSVFYTSPTVIRAAMRE
DDSVVQSRSLSSLRVLGTVGEPISPEAWKWFYAEVGRNACPVVDTWWQTETGGVMITACA
QNVAAKPGAAGLPLPGVAATLTDTKGQDIEGEGEGLLCLAQSWPGQAMTLWQDHERFRKT
YFTTCPGHYFSGDGARRDATGYYWITGRVDDVVNVSGHRIGTAEIEDAVAEDHAVVESAA
VGVPHDLKGQALVVFVVPKAEGAFDATAVNKAVAAGVGRYAVPEKIYVVPDLPKTRSGKI
VRRLLRKIAANDLENMGDLSTLADPDIVAELIKLVAQQNG
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
gtggtagatgcgtttttccccgcaacggataaccccgtttctgatcggtatcaggatctt
gtgcagcgggcgcaacgtgatccggaggaattctggctggctcaggcgcaaaggctggca
tggcatacgcaacccatgcacgcatctcgctctgactttaccggcgatgtgcgggtttcc
tggtatgaagacgggcggctgaatgcggctgaaaactgtctggaccggcacgttctgtat
cagcccgataatgctgccctgatctggcaggggcaggaagacggccaccgcgaggtgctc
tcataccgtgaactgcatgcccgcgtctgccgcttgggcaatgtgctgcgccgtttgggt
gtaaaaaagggagaccgcgtggccatccatctgcccatggtggcagagggtgttatttcc
atgctggcctgcgcccgtattggggccgtgcacgtggtgctgtttggtggtttttctgcc
gagggtctggcagaacgtttgacagatagcggcgctgtggtggtgattaccgcagatgtg
gcgcgccgcgggcccaagaaaattcccagcaagaccacaatggatgaggccataaaattg
tgcggggcacaaagtgccgtgcgcaatgtgctggtggtgcctgtaacgggtgctgatgtg
cccatgcaaaaggggcgggacctgtcctacacagcagaagtagcgcttgaaataccggat
tgcccgccagaagtgatgaacgcgtgtgatccgctgtttctgctttacacatccggcagc
acgggccgccccaaagggctggtgcacagcacgggcgggtatctggtgtgggcgtctttc
acacaggagctggtgtttgatgccaaacccagtgatgtgttctggtgtacggcagataca
agctggattaccggccacacctatgttgtgtacgggccgctggtaaatggtggcaccatt
cttgtgtatgaaggcctgccatcatggccacagcccggccgctggtgggatgtgatagac
cagaaccaggtttcggttttctatacgtctcccacagttattcgcgctgccatgcgtgag
gatgattccgtggtgcaaagccgctctctgtccagcctgcgtgtgctgggtacggtgggt
gagcctatcagcccggaagcatggaagtggttttatgcagaagtagggcgcaatgcctgc
ccggtggtggacacatggtggcagacagaaaccggcggtgtgatgattaccgcctgcgcc
cagaatgttgctgctaagccgggagccgcagggctgcctttgccgggtgtggccgctacg
ctgacagataccaaagggcaggatattgaaggcgagggcgaaggcctgttgtgccttgcg
caatcctggcccggacaggccatgacgctgtggcaggaccacgaacggtttcgcaaaacc
tatttcaccacatgcccgggccattatttctcgggtgatggcgcacgacgggatgccacc
ggttattactggattaccggccgcgtggatgatgtggtgaacgtatctggccaccgcatt
ggcacggcagaaattgaagatgccgtggccgaagatcatgccgtggtggaaagtgccgcc
gttggcgtgccgcatgatctgaaagggcaggcccttgtggtgtttgtggtgcccaaggcg
gagggcgcgtttgatgccacagccgtaaacaaggccgtggccgcaggcgtgggccgctat
gcggtgccagaaaaaatttacgtggtgccggatctgcccaaaacacgttcgggcaaaatt
gtgcggcgtttgctgcgcaaaattgcggcgaatgatctggaaaatatgggggatctgtcc
actctagcagacccggatattgtggctgaactgataaagctggtggctcagcagaacggc
tga

DBGET integrated database retrieval system