KEGG   Acetobacter pasteurianus IFO 3283-07: APA07_07200Help
Entry
APA07_07200       CDS       T01813                                 

Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
apu  Acetobacter pasteurianus IFO 3283-07
Pathway
apu00920  Sulfur metabolism
apu01100  Metabolic pathways
apu01120  Microbial metabolism in diverse environments
apu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    APA07_07200
Enzymes [BR:apu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     APA07_07200
Transfer RNA biogenesis [BR:apu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    APA07_07200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P XdhC_C
Motif
Other DBs
NCBI-ProteinID: BAI04967
Position
complement(743102..743872)
Genome map
AA seq 256 aa AA seqDB search
MTSHTDADLLALAARLADEAAEIIRTIRARGFETITKTDSSPVTEADHAAEAHILRGLRA
ATPDIPVIAEEEVAAGKQTAVAPAYWLVDPLDGTREFAAGRDDFTVNIGLVRDGRPVLGA
MALPAYHQLYTGGVGLGAHRTDKNGTQPIHVRKAPAEGLTVLASRHHADDKRLADYLNGR
PVAKLGNIGSAVKFARVAEGLVDLYPRLGPTMEWDTAAPQAIVEAAGGNITLLDGSPLVY
GKTGWKNPPFVCTGTL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacaagccataccgatgccgaccttctggccctagcagccagactggccgatgaagct
gctgaaattattcgtacaattcgtgcgcgcggctttgaaaccataaccaaaaccgattct
tcccccgtaacggaggcagaccacgctgcagaagcgcatattctgcgcggcctgcgggca
gcaacaccggatattcccgttattgcggaagaagaagtggctgctggcaaacagactgcc
gtagcccccgcctattggctggtggacccgctggacggcacgcgtgaatttgccgccggg
cgtgatgattttaccgtaaatatcgggctggtgcgtgatggccgcccggtgctgggtgct
atggcactgccggcttatcatcagctttatactggtggcgtaggcttgggcgcgcaccgc
acggataaaaacggcacgcagcccattcatgtgcgcaaagctccggcagaagggctgact
gttctggcatcccgccaccatgcagatgacaaacgtctggcagactatctgaatggccgc
ccggttgccaaactgggcaatattggctctgccgtaaaatttgcccgtgtagccgaaggg
ctggtagacctttacccacgccttggccccaccatggaatgggataccgcagccccgcag
gctattgtggaagctgctggcggaaatattacgctactggacggttctccgctggtttat
ggcaaaacgggctggaaaaatccgccgtttgtctgtaccggaacgctgtaa

DBGET integrated database retrieval system