KEGG   Acetobacter pasteurianus IFO 3283-07: APA07_12340Help
Entry
APA07_12340       CDS       T01813                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
apu  Acetobacter pasteurianus IFO 3283-07
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:apu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1293258..1294097)
Genome map
AA seq 279 aa AA seqDB search
MPELPEVETVMRGMQIALQNGTIKEAIVRRHDLRWRIPADFSQTIKGRRIEGFRRRGKYI
LMRLSGGMSIIWHLGMSGRVLLDSPTEPLPHEHVVLILQDGKRCGYIDPRRFGMLDLVPT
DQEDTYPLLVGMGPEPLEPDFTPKTLLAASKNRRMPIKPFLLDQKVVAGLGNIYVCEALF
RAGIAPTMPACNLTPPKACKLAQAIRDVLEEAIEAGGSSLKDYVRPEGGLGYFQHAWRVY
GQTGKPCPNCPGTPACSGVQQITQAGRSTFFCPQRQKNG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactccctgaagtagaaaccgtaatgcgcgggatgcagattgccctgcaaaac
ggtaccatcaaagaagcaattgtgcgccgtcacgacctgagatggcggattcctgccgat
ttctcacaaacaatcaaaggccgccggatagaaggctttcgtcgccggggcaaatatatt
cttatgcgcctgtctggtggaatgtccataatctggcatttgggtatgtctgggcgtgtg
cttctcgattctccaaccgagccgttaccgcatgaacacgtcgtgctgattctgcaggac
ggaaagcgctgcgggtacatagatccgcgccggtttggtatgctggacctggtgcccaca
gatcaggaagatacctacccattgctggtaggcatggggcctgagccacttgagccagat
tttacccccaaaaccctactagcagccagtaagaacaggcggatgcctatcaaacctttt
ctgcttgatcagaaggttgtggcggggttgggcaatatttatgtgtgcgaggccctgttt
cgggctggcattgctccaaccatgccagcctgcaatcttacgccccccaaagcctgcaaa
ttggcgcaagccatacgagatgtgctggaagaggccatagaagcgggtggctccagcctg
aaagattatgtgcggccagaaggcgggctaggatacttccagcacgcatggcgggtatat
gggcaaacgggcaaaccatgccccaattgccccggcacccccgcatgttctggcgtgcag
cagataacacaggccggacgatccacatttttttgtccccaaaggcagaaaaacgggtaa

DBGET integrated database retrieval system