KEGG   Acetobacter pasteurianus IFO 3283-07: APA07_19190Help
Entry
APA07_19190       CDS       T01813                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
apu  Acetobacter pasteurianus IFO 3283-07
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:apu00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2090247..2090876
Genome map
AA seq 209 aa AA seqDB search
MPLQSAPFPLAFIPGKTDALIVVDVQNDFLPDGALPVPKGHAIVPVINRLAHLPFGLIVT
SQDWHPSDHVSFKTTHQNGLWPPHCVANTPGADFPQDLHLPEQTLHLFKGAQSGQDSYSA
FGAKTQSGLLLDAVLKQHGITRVFVCGLALEYCVQATALDAQKAGYTTVLLTDATQGLEA
DPTPTLTACQAKGILLYSGLQLHIPSPTR
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgccactgcaatccgcgcctttccctcttgcctttataccgggcaaaacggatgcgctg
attgtggtggatgtgcagaacgattttctgccagatggcgccctgcctgtgcccaaaggc
catgccattgtgcctgttatcaacagattggcacatttaccgtttgggttgatcgtgacc
tcgcaggactggcacccatccgatcatgtttctttcaaaaccactcatcaaaacggtctg
tggcctccgcattgtgtagccaacacacccggcgctgattttccccaagatttacacctg
cctgaacagaccctgcacctgtttaaaggcgcacaatccggtcaggacagctactctgct
tttggggccaaaacacagtcgggcctgttgctggatgctgttttaaaacagcatggcatc
acgcgtgtttttgtgtgtggcttggcattggaatactgcgtgcaggccacagcactagat
gcgcaaaaagccggatatacaaccgtgcttcttacagatgctacccaaggcctagaggct
gaccctacccccactttaacggcctgtcaggcaaaaggcattttgctgtattctggttta
caattacacataccttctccaacacgctga

DBGET integrated database retrieval system