KEGG   Atopobium parvulum: Apar_0102Help
Entry
Apar_0102         CDS       T00983                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
apv  Atopobium parvulum
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Apar_0102
  Lipid metabolism
   00600 Sphingolipid metabolism
    Apar_0102
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Apar_0102
Enzymes [BR:apv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Apar_0102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111583..116928
Genome map
AA seq 1781 aa AA seqDB search
MTSRLRKVSAICAALAFVLGVFYIAQPTYAEEQPAEVRSQSTTQMNSAPENVNVNIINDT
TNRVQNFNSNWKFKLGDASGAENTTYDDSSWESVNLPHDYSIDQPYSQSGEAESAYKPGG
EGWYRKTFEVASNLQGKRFRLDFDGVYMDSTVWVNGHMLGTHPYGYTPFAFDITPYIKPG
EQNVITVRVNAQTPSSRWYSGAGIGRDVDLVVTNPVHVSKDGVKATAPNLASEVGGSVTT
QLTTSVTNSSDSPVNVQVVQTVFARGTSPQQAIASVTTERSINANTTDTFNASAITSSSP
ALWDIDNPNLYTVRTEVKVDGNVVDTYDTTFGYRYFSFDAEKGFLLNGMPVKIKGVCMHH
DQGALGSVSTADAVRRQVQILKNMGANAIRTSHNTPSRELIEACNEQGVLLDYEFFDGWT
AAKNGNSKDYARFFSTVMGESELIGGDANKTWAQFDIEASVARDYNAPSIVMWSLGNEMT
EGTYGIYGLAQVQNSLIAWTQAVDPTRPVTTGDNRLKRGSNELNPQGISDAGGIVGMNYA
GGSTYDSIHSQHPDWKLIGSETASSINSRGIYSTHSRDNSSQQLTAYDYSRVNWGHYASQ
AWYDVLTRDFVAGEFVWTGFDYLGEPTPWNGVDPGAKGRWPSPKNSYFGIIDTAGLPKDS
YYFYQSQWNDAVHTLHLLPAWNGDAVKKNRDGTVDISVYTDAHAVRLYFTPAGSTEKQDL
GLKTFTTKTTPTNGFTYQIYEGADKSTDEFRNLYLTWQVPYADGTITAEAYDEAGNVIDT
SSWDGRQSLTTAGQPKKLSVSANRSSMSANGTDLTYLTVDVVDENGNRVPNANNKVTFDV
FGSGKLAGIDNGSAPDHQSYRDANRDAFSGQVVGIVQAGTKAGEVTVRVSADGLEPTEVT
IPVTPANTSDDTPQKTVGSLFYSRYYYVKTGSSLTLPKTIQARYTDGTASDEPVVWDLYD
AEKLNSAGTFTVSGTVAGVRATVTVTVLDNIAALMNYSTTTPVGQNPILPDARPAVQADG
TVLRANFPVTWNAVPEGSYNQEGTVTVTGTANVFGRDMSVTATVRVQRETVTLGENVAPV
ASVSQDIPEDKQSDTLSAITDGSTSVAANQGGGANPTCWTTYKNAQAGNQTASITFRYAT
QQRIGQARVHFFVDSYSARLPKPGSTIIEVSENGEDWTRVDAQETVGQAQGRVTPYTYNF
APVTATYVRFTITNSDEVLAGRKPCTGITEVELFSAVGSFTTNNTASFDSLSVNGKQVSE
DALAAGEYNTPALLTNVEAQTKDNAALTVLPPYQNKVKMLLESEDHTSRSTFTVNLGVDQ
PITGDSDAQDYPVDKMLVSAGSEVEDRYVSPNEGKVLLAFDGNPSTYWHSTWAPSSTDDH
WVQMELDEPTTIEALRYLPRPNSPANGTVTEALVEYSDDGVTWHEAGRATWTSPTSPDYT
PDWKIVKFNQPVTAKYFRLTGVHTYADGGRNDKFMSAAEIRLRTTKETTDISHARIEAPS
TLTVDSVSESNPAMFNPSDVHVYVPSTKSGESRRTRRSVTDETELRYGIDYVLEYENNTS
EGTATVRARGIDSYAGTTAPTPFTVALTQVVVDSVSVASTPTKTAYTVGEKLDPSGLKLT
LAMSNGTSQEVTYSEDNKDDFTFDPSAEAAFDTAGTHEITVTYQGKSATFEVTVTQATNP
ANPTDPTNPTNPSDPTNPTNPADPSNPANPTDPSNPDGNQSADNGANNVNSNTDQGNSSK
KKRTSALPGMGDPVTLVAACGLLTIGITCAGGGYWVRRRRH
NT seq 5346 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtcgtttgcgcaaagtatctgcaatatgtgcggcattagcttttgtgttaggt
gtgttttatatagctcaacccacgtatgcagaagagcaacctgctgaggtgaggtctcaa
tcaacaacgcaaatgaattctgcgcctgaaaatgttaacgttaacattattaatgacacc
acgaatcgtgtgcagaacttcaattcaaactggaagttcaaacttggtgatgcatcaggt
gcagaaaacacaacgtacgatgactcttcttgggaatcagttaatcttcctcacgactac
agcatagatcagccctattctcagtccggagaggcagaaagcgcctataaacctggtgga
gagggttggtatagaaagacttttgaagttgcttccaatcttcaaggaaagcgttttcgt
ttagattttgatggcgtctacatggattcaactgtgtgggtcaatggccatatgttgggt
actcatccgtatggttacacgccgtttgcttttgatatcacgccatacattaaacctggc
gagcaaaacgtcattaccgttcgtgtaaacgcacaaacaccaagtagtcgttggtattcg
ggcgctggtattggccgtgacgttgatcttgtggtgacaaatcctgttcatgtttcaaaa
gatggtgtaaaagcaactgctccaaatcttgcatctgaggttggcggaagcgttaccact
caattgaccacttcagtaacaaattcatctgattcacctgtaaatgtacaggtagtacag
actgtctttgctcgcggaacttctccccagcaggctattgcatccgttaccacagagcgt
agtatcaatgcaaacacaactgatacgtttaacgcttctgcgattacttcatcttcacca
gcgctttgggatattgataaccccaatctctataccgtacgcactgaagtaaaggtagac
ggaaacgttgttgatacctatgacacaacctttggatatcgttattttagctttgatgcc
gagaagggcttcttactgaacggtatgcctgtcaagataaaaggtgtttgtatgcaccat
gaccagggcgcacttggctctgtatctactgccgatgcagttaggagacaggtacagatt
cttaagaatatgggcgccaatgccattcgtacttctcataacacaccctctcgcgagctt
attgaggcatgtaacgagcaaggtgtcttattagactatgagttctttgacggttggact
gccgcaaagaacggtaatagcaaggattacgcaaggtttttctcaacggtgatgggggaa
tctgagcttattggtggcgacgcaaacaagacgtgggcacagtttgatattgaggccagt
gttgcacgtgattacaatgcgccatccattgtgatgtggtcgcttggtaatgagatgact
gagggtacctatggtatttatggtttagctcaggtccaaaatagtctaattgcctggaca
caggctgttgatccaactcgccctgttactacaggagataaccgacttaagcgtggatca
aatgagctaaatcctcagggaatttctgatgctggcggtattgttggcatgaactacgct
ggtggttctacgtacgatagtattcacagccaacatccagattggaaacttattggctct
gaaacagcttcgtcaattaatagtcgtggtatttacagtactcatagtagagacaactct
tctcagcagcttactgcatacgattattctcgtgttaattggggtcattatgcttcccaa
gcatggtatgacgtactgacacgtgattttgttgctggagaatttgtttggactggcttt
gattatctgggtgagccaactccttggaacggagttgatcctggcgcaaaaggtagatgg
ccatctccaaagaattcttattttggcatcattgatactgctggtttgccaaaagattcg
tattatttctatcagagccagtggaatgatgctgttcacacattgcacttacttcctgca
tggaatggtgatgctgtaaagaaaaaccgtgatggcactgttgacatatcggtttatacc
gatgctcacgctgtcaggctttatttcactcctgctggctcaacagagaagcaagattta
ggtctcaagacatttacaacaaaaacaacaccaactaatggttttacgtatcagatttat
gaaggggccgataagagtactgacgagttcagaaatctatatctgacctggcaagttccg
tatgctgacggcactatcaccgccgaagcatacgatgaagcaggcaatgttattgatact
tcgagctgggatggccgtcagagtctaactaccgcaggtcaaccaaagaaactttcagta
tcagcaaaccgctcttctatgagcgcaaacggtaccgatttgacatatttgaccgtagat
gttgttgacgagaatggcaatcgtgttccaaacgctaacaataaggtaacgtttgatgtt
tttggatctggcaaattagcaggaattgataacggcagcgcgcccgatcatcagtcatat
cgcgacgctaaccgagacgcgttctcgggacaggttgtgggaattgttcaggcgggaaca
aaagcgggtgaggttaccgtacgtgtttctgctgacggcttagagccaacagaggttacc
attccagttactcctgcaaatacaagcgatgatactcctcagaagacagttggaagtctg
ttctattctcgttattactacgttaaaacaggctcttcactgacattacctaaaacaatt
caggctcgatatactgacggaacagcttcggatgagcctgttgtttgggatttatatgat
gccgagaaactcaactctgcaggtacctttactgtttctggaacagttgcaggtgttcga
gctaccgtaacggtgacggtattagacaatattgccgctcttatgaactactcgacaaca
acaccagttggtcaaaaccctattcttcctgatgcacgaccagcagttcaggcggacggc
accgttttacgggctaatttcccagtaacttggaatgctgttcccgagggctcctataac
caggagggaacagttactgtcactggtaccgcaaacgtttttggccgtgatatgtccgtc
acagcaactgtgcgtgtgcagcgagagactgtaacgttgggtgagaatgttgctcctgtt
gcatcagtctcgcaggatattcctgaagacaaacagagtgacacactttctgctattact
gacggctctacttcagttgcagccaatcaaggcggtggagctaatccaacttgttggaca
acgtacaagaacgcacaggcaggaaaccaaactgcgtccattacgttccgctacgcaact
cagcagagaattggtcaggctcgcgttcacttctttgtagactcttactccgcaaggttg
cctaagccaggatcaactatcatcgaggtttctgagaatggcgaggattggactagggtt
gacgcacaagaaacagttggacaagcacaaggtcgtgtaactccttacacgtataatttt
gctccggtaaccgctacgtatgtgcgttttaccattaccaactctgatgaggttcttgct
ggaagaaagccgtgtacaggtattactgaagttgagctcttcagtgctgttgggtcattt
actacaaataatacggcttcatttgattcgctttctgtaaatggaaaacaggtaagtgaa
gatgctctagcagcaggggagtacaacacaccagctcttctcactaacgtagaggcgcag
acaaaagataacgctgcactgactgtactgcctccttatcaaaataaagttaagatgctc
cttgaatctgaggatcatacttctaggagtacgtttactgttaatctgggagttgatcag
ccaattactggcgatagtgatgctcaagattacccggtagataagatgcttgtctcggca
ggtagtgaagttgaggatagatacgtaagtccaaatgaaggcaaggttttgctggcgttt
gacggtaatcctagtacatattggcactccacttgggcaccaagttcaaccgatgaccac
tgggttcagatggaacttgatgagccaacaactattgaggcgctgagatatctacctcgt
cctaatagcccagcaaatggaactgttactgaagcgttggttgagtacagtgacgatggt
gttacttggcatgaggcggggcgtgctacatggacttctcctaccagccctgattacact
cctgactggaaaatagtcaagtttaatcaaccagttacggctaagtatttccgtctaact
ggtgtccatacgtatgcagatggtggacgtaacgataaattcatgagtgcagcagagatt
cgcctgcgtactacaaaggaaacaactgatatttctcatgcacgtatagaagcacctagt
accctgacagttgattctgtgagtgagtctaaccctgcgatgtttaatccgtctgacgtg
catgtgtatgtcccatcaacaaaaagtggagaatctcgacgcacaaggcgttcagttacc
gatgagactgagctgagatatggcattgattacgttcttgagtacgagaacaatacatct
gagggaaccgcaacagtacgtgctcggggaattgattcgtatgccggcacaactgcgcct
acaccgtttacggttgctcttacacaggtggtggttgatagtgtatcggttgcttcaact
cctactaagactgcgtacactgtaggtgagaagcttgatccgtcagggctcaagttgacg
cttgccatgagtaacggaacgtcgcaggaggtaacatatagcgaagataacaaggatgac
tttacgtttgatccttcagcagaggctgcgtttgatactgctggtacacatgagattacg
gtgacctatcagggtaagtctgctacgtttgaggttactgttacacaagcaacaaaccct
gccaatccaacagatccaacaaatccgactaacccatcggatccaacaaacccaacgaat
ccagcagatccttctaaccccgccaatccaacagatccatccaatccagatggcaatcag
agcgctgacaatggtgccaacaatgttaatagcaatactgaccagggaaattcttctaag
aagaagcgcacttctgcacttcctggtatgggtgacccagttacgttagttgcagcatgc
ggattgcttactataggtattacgtgcgctggcgggggatattgggtacgtaggcgcagg
cattag

DBGET integrated database retrieval system