KEGG   Atopobium parvulum: Apar_0117Help
Entry
Apar_0117         CDS       T00983                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
apv  Atopobium parvulum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Apar_0117
DNA repair and recombination proteins [BR:apv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Apar_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
132168..132779
Genome map
AA seq 203 aa AA seqDB search
MAFDTTNDGRALQRLLDELGRLPGIGPKSAQRIAYHLLEVDSEEARRLAQVILELKQQVH
FCPICFNYATRNECDICLDSSRDRSKICVVSEPKDVSAIERTGAFHGLYHVLGGVISPMD
KIGPEQLHVRELLSRLADGTVTEVVLATNPDVEGETTATYLSRTINPLGVRVTRLASGLP
VGGDLEYADEVTLGRAIEARREV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgataccacaaatgatggtcgtgcgctgcagcgcttacttgatgagttaggt
cgcctaccaggcattggtccaaagtcagcccagcgtattgcgtatcatcttttagaggtt
gattccgaggaagctcgccgtttagctcaggtcatcttggagcttaagcagcaagtacat
ttttgtcctatctgctttaactatgcaacgcgcaacgaatgcgatatctgcctggattct
tctagggaccgcagcaaaatatgtgtggtctccgagccaaaggatgtctcagcaattgag
cgtactggtgcgttccacggtctctaccacgttctgggaggcgttatttctcctatggat
aagattggtcccgagcagcttcacgtgcgcgaactgctgtctcgtttggctgatggcacc
gtaaccgaggttgtcttggcaaccaatccggatgttgagggagaaacaactgcaacgtac
ctctccagaactattaatccgcttggcgtgagggttacccgattagcaagtgggcttccc
gtaggcggagatcttgagtatgcggacgaggtaacattgggacgcgcaattgaggcgcgt
cgggaggtttaa

DBGET integrated database retrieval system