KEGG   Atopobium parvulum: Apar_0166Help
Entry
Apar_0166         CDS       T00983                                 

Definition
RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
Orthology
K02428  
dITP/XTP pyrophosphatase [EC:3.6.1.19]
Organism
apv  Atopobium parvulum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:apv00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:apv00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192470..193120
Genome map
AA seq 216 aa AA seqDB search
MSQDNATNQNTKAVFDPNKTIVVATGNTHKLVEIEAILSKVMPGISFVALGQLGDFPDPE
ENGKTFRDNALIKAMAALDEVDCVAAIADDSGLCVDALDGAPGIYSARYAGEHGNDAANN
KKLLAELADVADAERTARFHSTVALVYRDGRVLVGEGDCEGVIGHEPKGCNGFGYDPLFW
PNDAPGKAMAELSPNQKNAISHRFHALQNLSEQILH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggataacgctactaaccagaatactaaggctgtatttgatcccaacaagacc
atagttgtggcaacgggaaacactcataagttagttgagattgaggcaattctttctaaa
gttatgcctggtataagttttgttgcccttggtcaactgggtgattttcctgatccagaa
gaaaacggaaagacttttcgtgataatgcgttaattaaagcaatggctgcacttgatgag
gtagattgtgtagcagctattgctgatgactctggtctttgcgtagatgctcttgatggc
gctcctggaatttattctgcacgttatgcaggagagcatggtaatgacgccgctaacaat
aagaaactgttggctgagcttgctgatgttgcagacgctgagcgtactgcacgctttcac
tcaactgttgccctcgtatatcgtgacggtcgcgtacttgtaggtgagggagactgtgaa
ggcgttattggtcatgagccaaagggctgcaatggttttggttacgacccgctgttttgg
ccgaatgatgcaccaggtaaagctatggcagaactttctcccaatcagaaaaatgctatt
tcccaccgtttccatgcactgcaaaatctctcagagcaaattcttcattaa

DBGET integrated database retrieval system