KEGG   Atopobium parvulum: Apar_0169Help
Entry
Apar_0169         CDS       T00983                                 

Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
apv  Atopobium parvulum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Apar_0169
Enzymes [BR:apv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Apar_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194549..195451
Genome map
AA seq 300 aa AA seqDB search
MNSTLMTASTSYSGRQSAQVPCKINLHLGIHTQKNQRGYHKVDSLMVPVAIYDTVTVNDA
PELTVTHDPTLCVIPERTTTWKAAVLLAHKLGISPDVSIDVHVHIPEKAGLGGSSADAAA
TLRLLAERWGVDSLDPLVVDVAKSVGADVPFFLDPRPSLMLGAGDTLEEAYTPTCDAPLV
IVLPAEKGILTQAAYDQFDVAPEPPASYEALASLFTSGEKTVQQVADLLFNNLAPAAKIL
EPHVAEVEAWLKQQPGVLGAQVSGSGSSSFALCESQDAADAIADAAKAMGWRGYSTQCEL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagtactcttatgactgcttctacgtcttatagtggacgtcaatccgcacaagtt
ccttgcaagattaatcttcatctgggtattcatactcagaaaaatcagcgaggctatcat
aaagttgattcacttatggttcccgtggccatctacgacaccgttacggttaacgatgca
ccggagcttacggtaacgcacgatcctacactctgcgttatacctgaacgtacaaccacg
tggaaagcagctgtacttttagcgcacaagctgggaatttctcctgatgtctctattgac
gtgcatgtacacattcccgagaaagccggtttaggtggatcgtctgccgatgcagctgca
acgttgcgcttgcttgctgagcgttggggggttgactcgttagatccgctggtagttgat
gtggcaaagtctgttggagccgatgtaccgttcttcttggatccgcgtccttctcttatg
cttggtgctggcgatacgctggaagaggcttatacacctacatgtgacgcaccgcttgtc
attgtattacctgcagaaaagggtattttgacacaggccgcctatgatcagtttgatgtt
gctccagagccaccagcatcgtatgaagcactcgcttcattgtttacttctggcgagaaa
accgtccaacaggtagctgatttactgtttaataatctggcgccagctgcaaaaatactt
gaaccgcatgttgctgaggttgaagcttggcttaaacagcagccaggtgttcttggggct
caagtctcgggttctggtagtagttcgtttgcactttgcgagtctcaggatgcagcggac
gctattgctgacgctgctaaggcaatgggatggcggggctattccactcaatgtgagttg
tag

DBGET integrated database retrieval system