KEGG   Atopobium parvulum: Apar_0233Help
Entry
Apar_0233         CDS       T00983                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
apv  Atopobium parvulum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apv01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:apv00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(269150..270412)
Genome map
AA seq 420 aa AA seqDB search
MSSRTNFDASKLPNNLPEVAKMTAQLVALKSTDPGSYEEEIETFIKTWIVNSCSFSLPNK
KEMFPIIQEVEVFPHRRCLRATIPSATTSFDSSTLPPSDLTFICHMDTVTDGDGWDSETP
AFNPVYKDGLLYGRGSCDMKGGLACALLAFRDACQTCKTQKTLPQKSLSVIFTVDEEANM
RGVERVIDAGWVGEKGWVLDAEPTNNAIRGSHKGRTWFKITVTGITAHASTPWKGADAIA
AMAIVINEIRTAVQSLPTHPELGSSTVTFGQILGGYQPYVVPDKAELWVDMRLAPPTTTQ
AAERIVQQAIKRAQTEICGTHASYDITGNRPSVVLPKDSELLAQLLSCAESCNTPAKLDI
FTGYTDTAVIASTCRNTECMSYGPGELERAHKPNEYVPVEDLTRVYRVFKSLIKSTICDF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcagaactaattttgacgcatccaaacttcctaacaacctaccagaagttgca
aaaatgacagcacaacttgttgctcttaaaagtactgatcctggttcttatgaagaagag
attgaaacatttattaaaacgtggattgttaactcgtgttctttttcactgcccaataaa
aaagagatgtttcctatcatccaagaagttgaagtttttcctcatagacgttgccttagg
gcaacaatccccagtgctaccacatcatttgattcctctacactccccccatcagacctg
acatttatctgccatatggataccgtaactgatggcgatggctgggactctgaaacacct
gcattcaatcccgtatataaagatgggctgctgtatggacgaggctcatgtgatatgaaa
ggggggcttgcctgtgcacttctcgcctttagagacgcttgtcagacatgcaagacacaa
aagacacttccacaaaaatctctttctgtcatcttcacagttgacgaagaagctaatatg
cgcggcgttgaacgtgttatagacgctggttgggttggcgagaaaggctgggtacttgac
gctgagcctacaaacaacgccatccgtggatctcacaaaggtcgaacctggttcaaaatt
actgttaccggaatcacagctcacgcaagcaccccttggaaaggtgctgatgctatcgct
gcaatggcaattgttataaatgagatacgaactgcagtgcagagcctacccactcatcca
gagcttggatcatcaacggtaacctttgggcagattttgggtgggtatcaaccgtacgtt
gttcctgataaagccgaactctgggttgacatgcgcttagcaccccctacaacaacgcaa
gctgcagagcgtatagtgcaacaagcaatcaagcgagcccaaacagagatttgcggtact
cacgccagctatgacattacgggaaataggccttccgttgtccttcccaaggattcagaa
cttctcgcacagcttctctcgtgtgcagaatcttgcaatacgcctgcaaagctcgatatt
tttactggatataccgataccgctgtaattgcatccacctgcagaaatacagaatgtatg
tcatatggacctggagaacttgaacgtgctcataaaccaaatgagtacgttcctgtagaa
gatttaacacgcgtatatcgtgtatttaaatcactgataaaaagtaccatatgcgacttt
taa

DBGET integrated database retrieval system