KEGG   Atopobium parvulum: Apar_0356Help
Entry
Apar_0356         CDS       T00983                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
apv  Atopobium parvulum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Apar_0356
   01230 Biosynthesis of amino acids
    Apar_0356
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apar_0356
   00030 Pentose phosphate pathway
    Apar_0356
   00051 Fructose and mannose metabolism
    Apar_0356
   00052 Galactose metabolism
    Apar_0356
  Energy metabolism
   00680 Methane metabolism
    Apar_0356
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Apar_0356
Enzymes [BR:apv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Apar_0356
Protein phosphatases and associated proteins [BR:apv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Apar_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(408660..410042)
Genome map
AA seq 460 aa AA seqDB search
MRKIRKILIGQSGGPTVAINSSLAGIVARAHEEGIEIYGMQNGIEGFLNGRYTNLTNLFF
PQENQQNRNVDQQEHIVNQQKRSVDQQEHGVDQRGADQQKHTVELLVKTPSSFLGSCRYK
LPEVSEKTSFYQDIECRLTSLEIDGILYIGGNDSMDTVNKLAAYFAQHNNDISVIGIPKT
IDNDLEGTDHSPGFGSSARYIATIVRELARDSEVYNKPNITIVETMGRDAGWLGAASALA
REKNEEAPDFILLPEVTYDEKRLLRKTAELFEHKNSVVIVISEGVRRPDGSTLLNKSHTK
MDAFGHLADQSGNALYLADLFQKHFDAKIRGINLNSLQRCAMHSSSKTDLSEAFELGKAG
VDALLAHKTGCMIGLQRLSDVPYQAEIRCIPISDIANRVKSVPAEMISDDGLWITEKALA
YLRPLVSNEELAFDADTRRFVSSNILPDNNGLPPFIPKLR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagattagaaaaatacttatcggtcaatcaggcggcccaacagtagcaatcaat
tcttctcttgcaggaattgtcgcgcgtgcgcacgaagaaggcatcgaaatttatggcatg
caaaacggaattgaaggatttctcaatggtcgctataccaatctgactaacctgttcttt
ccacaagaaaaccagcagaatcgcaacgttgaccagcaggaacatatcgtcaaccagcag
aagcgcagtgttgaccagcaggaacacggcgtggaccagcgcggagctgaccaacagaaa
cacaccgtagaacttctcgtcaaaacgccttcgagctttctgggaagctgtcgatacaag
cttcccgaagtatccgaaaaaacatccttttaccaagacattgaatgccgcctgacctcc
cttgaaatcgacggcattctctacattggcggcaacgattctatggacaccgtcaacaag
cttgcggcttactttgcccagcacaacaatgacatttccgtcatcggcattcccaaaacc
attgataacgacctcgaaggcaccgatcactcgccgggttttggcagctcagcgcgatac
atcgctaccattgtccgcgaactagcccgcgactccgaggtttacaacaagccaaacatc
actatcgtcgaaactatgggccgcgatgcaggctggttgggcgcggcttcggctcttgct
cgcgagaaaaacgaagaagctccagactttattctgctccccgaggttacttacgacgag
aaacggctacttcgcaagacggcagagctatttgaacacaaaaacagcgttgtaattgtt
atcagtgagggagttagaagacccgatggctcaacgcttctgaacaaaagtcacacaaaa
atggatgccttcggccatcttgcagatcagtccggaaacgccctttatctggccgacctt
ttccagaagcactttgacgccaagattagaggcatcaacctcaactcactgcagcgctgt
gccatgcattcgtccagcaaaactgatctgtccgaggcgtttgagctgggaaaagccgga
gtagacgcactccttgcccacaaaactggctgcatgattggtctgcaaaggctcagcgat
gtgccataccaagctgaaatccgctgcatccctatctcggatattgctaatcgagtgaag
tctgtacctgcggaaatgatctctgacgacggcctttggattaccgagaaggccctcgcg
tatcttcgtcctcttgtctctaatgaagaactagcttttgacgcagataccaggagattt
gtcagcagcaacatcttgcccgacaataacggtctgccaccatttatcccaaagctaaga
taa

DBGET integrated database retrieval system