KEGG   Atopobium parvulum: Apar_0426Help
Entry
Apar_0426         CDS       T00983                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
apv  Atopobium parvulum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Apar_0426 (gpmA)
   01230 Biosynthesis of amino acids
    Apar_0426 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apar_0426 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Apar_0426 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Apar_0426 (gpmA)
Enzymes [BR:apv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Apar_0426 (gpmA)
Exosome [BR:apv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Apar_0426 (gpmA)
  Exosomal proteins of melanoma cells
   Apar_0426 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(493285..494046)
Genome map
AA seq 253 aa AA seqDB search
MAEDQYMHLVIVRHGESEWNKLNLFTGWTDVDLTETGHEEATAGGRALKEAGYDFDVCYT
SLLKRAIHTLNHVLDELDRNWLPVHKTWRLNERHYGALQGLNKADAAKEHGEDQVKIWRR
SFDVQPPALEPGDERDPHIQEMFRDVPAEDLPYTECLKDTIARAWPYFEQEIKPQLEAGK
RVLIAAHGNSLRALVMQFEHLTPEEILEVNIPTGIPCAYTFDKDWNIVDKHYIGDPAVIE
AKINAVANQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagatcagtacatgcaccttgttattgttcgccatggtgagtctgagtggaac
aagctcaacctattcaccggttggaccgacgttgaccttaccgagactggtcatgaggaa
gcaacagctggcggtcgcgctcttaaagaggctggctacgactttgatgtttgctacact
tccctactcaagcgtgctattcacactctgaatcatgttcttgatgagcttgatcgcaat
tggcttcctgttcataagacttggcgtctcaatgagcgtcactacggcgctctgcagggt
cttaacaaggctgatgctgctaaggagcatggcgaggatcaggtaaagatttggcgtcgc
tcctttgatgtacagccaccagctcttgagccaggtgacgagcgtgatcctcacattcaa
gagatgttccgcgatgtcccagcagaggaccttccatacacagagtgcctgaaggacacc
attgcacgcgcatggccttactttgagcaggagattaagccacaacttgaggctggcaag
cgtgttctcattgctgcacacggcaatagccttcgtgctcttgttatgcagtttgagcac
ctcactccagaagagattcttgaggtcaacatcccaaccggcattccttgcgcatatacc
tttgataaggactggaacattgttgacaagcactatattggcgatccagcagttattgaa
gcaaagattaacgctgttgctaaccagggcaaagctaaataa

DBGET integrated database retrieval system