KEGG   Atopobium parvulum: Apar_0426Help
Entry
Apar_0426         CDS       T00983                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
apv  Atopobium parvulum
Pathway
apv00010  Glycolysis / Gluconeogenesis
apv00260  Glycine, serine and threonine metabolism
apv00680  Methane metabolism
apv01100  Metabolic pathways
apv01110  Biosynthesis of secondary metabolites
apv01120  Microbial metabolism in diverse environments
apv01130  Biosynthesis of antibiotics
apv01200  Carbon metabolism
apv01230  Biosynthesis of amino acids
Module
apv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apar_0426
  Energy metabolism
   00680 Methane metabolism
    Apar_0426
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Apar_0426
Enzymes [BR:apv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Apar_0426
Membrane trafficking [BR:apv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Apar_0426
Exosome [BR:apv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Apar_0426
  Exosomal proteins of melanoma cells
   Apar_0426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACV50857
UniProt: C8W9R9
Position
complement(493285..494046)
Genome map
AA seq 253 aa AA seqDB search
MAEDQYMHLVIVRHGESEWNKLNLFTGWTDVDLTETGHEEATAGGRALKEAGYDFDVCYT
SLLKRAIHTLNHVLDELDRNWLPVHKTWRLNERHYGALQGLNKADAAKEHGEDQVKIWRR
SFDVQPPALEPGDERDPHIQEMFRDVPAEDLPYTECLKDTIARAWPYFEQEIKPQLEAGK
RVLIAAHGNSLRALVMQFEHLTPEEILEVNIPTGIPCAYTFDKDWNIVDKHYIGDPAVIE
AKINAVANQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagatcagtacatgcaccttgttattgttcgccatggtgagtctgagtggaac
aagctcaacctattcaccggttggaccgacgttgaccttaccgagactggtcatgaggaa
gcaacagctggcggtcgcgctcttaaagaggctggctacgactttgatgtttgctacact
tccctactcaagcgtgctattcacactctgaatcatgttcttgatgagcttgatcgcaat
tggcttcctgttcataagacttggcgtctcaatgagcgtcactacggcgctctgcagggt
cttaacaaggctgatgctgctaaggagcatggcgaggatcaggtaaagatttggcgtcgc
tcctttgatgtacagccaccagctcttgagccaggtgacgagcgtgatcctcacattcaa
gagatgttccgcgatgtcccagcagaggaccttccatacacagagtgcctgaaggacacc
attgcacgcgcatggccttactttgagcaggagattaagccacaacttgaggctggcaag
cgtgttctcattgctgcacacggcaatagccttcgtgctcttgttatgcagtttgagcac
ctcactccagaagagattcttgaggtcaacatcccaaccggcattccttgcgcatatacc
tttgataaggactggaacattgttgacaagcactatattggcgatccagcagttattgaa
gcaaagattaacgctgttgctaaccagggcaaagctaaataa

DBGET integrated database retrieval system