KEGG   Atopobium parvulum: Apar_0539Help
Entry
Apar_0539         CDS       T00983                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apv  Atopobium parvulum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Apar_0539
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Apar_0539
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Apar_0539
Enzymes [BR:apv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Apar_0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(624637..626145)
Genome map
AA seq 502 aa AA seqDB search
MAVAYHSTRSFDHTVSAKQAILQGIAPDSGLYIQDSIGEKPLDLVKVCSQDFKSTAYDVL
STLLDDYLPEELNRCIEGAYGTQWDTKTITPVSAIGDDWLLELFHGPTSAFKDVALQMLP
RLMSVAREDTNAASTSGQNIMIVTATSGDTGKAALEGFKDVPGMGITVFYPEGKVSDIQR
LQMVTQKGSNIAVCAVNGNFDDAQNAAKAIFANKKLAQELAGKNTVLSSANSINIGRLAP
QVTYYFDAYAQLVAKGTITLGQKITFCVPTGNFGDVLAGYFAKEMGLPVDRLIVASNSNK
VLTDFLTTGTYDRRRAFEKTISPSMDILVSSNLERLLYLASGKDTELVSYLMNQLVTKGI
YTVPAQVMDTIRETFDAGFATDDQTRETIRSTWENCRMLIDPHTAVAKHVLDRVSRQTND
VRICLSTASPYKFSSDVLAALGHSTADLNDFACMHTLAEITGTNPPIQLSSLNDNVIIHT
DVREKEELASYVFEACERIFAC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgcatatcacagcacaagaagctttgatcataccgtctcggctaaacaggcc
attttgcagggaattgctcccgatagcggcctctacatccaagattctattggcgagaaa
ccccttgatcttgtaaaggtttgctcccaggactttaagtctacagcttatgacgtactt
tctactctgcttgatgactacttgcctgaggagttgaatcgctgtattgaaggtgcatat
ggcactcagtgggacaccaagaccattactcctgtttctgctatcggagatgattggctg
cttgagctcttccatggtccgacatctgccttcaaagacgttgcacttcagatgctccct
cgcttgatgagcgttgctcgcgaagacacaaatgcagctagtactagcggtcagaatatt
atgattgtcaccgctacttctggagacactggtaaagctgcacttgaaggcttcaaagat
gtaccaggtatgggtattaccgttttttatccagagggtaaagtctcggatattcaacgc
ctacagatggtgacccaaaaaggctcaaacattgctgtttgtgctgttaatggcaacttt
gatgatgcacaaaatgccgctaaagcaatctttgctaacaaaaaattagctcaggaatta
gccggcaaaaatactgtactttccagcgcaaactcaattaatattggtcgtttagctcca
caggtaacctactactttgacgcatatgctcaactagttgccaagggcactattacgctg
ggtcaaaagattaccttctgcgttccaactggcaactttggcgatgtccttgctggatac
tttgcaaaagagatgggattacctgttgatcgccttatcgtggcttctaacagcaataaa
gtgctaactgatttcttaacaacaggcacctatgaccgtagacgtgcatttgaaaaaacc
atctctccatcaatggatattctagtttcatcaaatcttgaacgacttctctatcttgca
tccggcaaagacaccgagcttgtcagctatctgatgaaccagctggtaactaagggtatc
tacacagtgcctgctcaggtgatggacaccatccgtgaaacctttgacgctggctttgcc
accgacgaccagacgcgagaaaccattcgttctacctgggagaattgtcgtatgctgatt
gatcctcacacagctgttgcaaaacacgtacttgacagggtttctcgccaaacaaacgac
gtgcgcatatgtctgtccactgcaagtccatacaagttttcgtccgacgtgcttgccgcg
ctgggtcactcgaccgctgacctgaatgactttgcgtgcatgcatacgctcgccgaaatc
acaggcactaatccgccaatccagctttcatcgctgaatgataacgttatcattcatact
gacgttcgcgagaaggaagaacttgcttcgtacgtttttgaggcatgcgaacgtattttt
gcttgttag

DBGET integrated database retrieval system