KEGG   Atopobium parvulum: Apar_0624Help
Entry
Apar_0624         CDS       T00983                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
apv  Atopobium parvulum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:apv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701591..702178
Genome map
AA seq 195 aa AA seqDB search
MAAENNYKELDQERVKAAVTEFLLAIGEDPEREGLLDTPDRVARACVELFGGMQEDPAVH
LRKQFHEEGNKEMVIVRDIPFSSTCEHHILPFVGKAHVCYIPQNGRITGLSKIARCVSGY
SRRLQVQERLTGQIADAMVEELDPLGVLVVMEAEHTCMSMRGIRASGALTTTSAVRGIFK
TNEKTRAEAMRLLGL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcagaaaataactataaagagcttgatcaagagcgtgtaaaagctgcggtcact
gaatttttgcttgctattggtgaggatccagagcgagaaggtctgcttgatacgccagac
cgtgttgctcgcgcttgtgtggagctctttggcggtatgcaggaagaccctgcagttcac
cttcgcaaacagttccacgaagaaggcaataaagagatggttattgtccgcgacattcct
ttctcatctacttgtgaacatcacattttgccatttgtaggtaaggcacatgtctgctac
atcccacaaaatggtcgtattaccggcctttccaagattgctcgctgcgtcagcggatat
tctcgtcgtctgcaggtacaggagcgcttaacgggccagattgcagatgccatggtagaa
gagctagatcccttgggtgttttggtggttatggaggccgagcatacgtgcatgagcatg
cgcggcattagggcatcgggtgctttgaccactacttctgcagttcgtggcatttttaag
actaacgagaaaacccgtgcagaagctatgcgtctgcttggtctataa

DBGET integrated database retrieval system