KEGG   Atopobium parvulum: Apar_0624Help
Entry
Apar_0624         CDS       T00983                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
apv  Atopobium parvulum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Apar_0624
Enzymes [BR:apv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Apar_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701591..702178
Genome map
AA seq 195 aa AA seqDB search
MAAENNYKELDQERVKAAVTEFLLAIGEDPEREGLLDTPDRVARACVELFGGMQEDPAVH
LRKQFHEEGNKEMVIVRDIPFSSTCEHHILPFVGKAHVCYIPQNGRITGLSKIARCVSGY
SRRLQVQERLTGQIADAMVEELDPLGVLVVMEAEHTCMSMRGIRASGALTTTSAVRGIFK
TNEKTRAEAMRLLGL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcagaaaataactataaagagcttgatcaagagcgtgtaaaagctgcggtcact
gaatttttgcttgctattggtgaggatccagagcgagaaggtctgcttgatacgccagac
cgtgttgctcgcgcttgtgtggagctctttggcggtatgcaggaagaccctgcagttcac
cttcgcaaacagttccacgaagaaggcaataaagagatggttattgtccgcgacattcct
ttctcatctacttgtgaacatcacattttgccatttgtaggtaaggcacatgtctgctac
atcccacaaaatggtcgtattaccggcctttccaagattgctcgctgcgtcagcggatat
tctcgtcgtctgcaggtacaggagcgcttaacgggccagattgcagatgccatggtagaa
gagctagatcccttgggtgttttggtggttatggaggccgagcatacgtgcatgagcatg
cgcggcattagggcatcgggtgctttgaccactacttctgcagttcgtggcatttttaag
actaacgagaaaacccgtgcagaagctatgcgtctgcttggtctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system