KEGG   Atopobium parvulum: Apar_0629Help
Entry
Apar_0629         CDS       T00983                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
apv  Atopobium parvulum
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Apar_0629
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apar_0629
   00620 Pyruvate metabolism
    Apar_0629
   00650 Butanoate metabolism
    Apar_0629
  Lipid metabolism
   00071 Fatty acid degradation
    Apar_0629
  Amino acid metabolism
   00350 Tyrosine metabolism
    Apar_0629
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Apar_0629
   00626 Naphthalene degradation
    Apar_0629
Enzymes [BR:apv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Apar_0629
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Apar_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
706866..709484
Genome map
AA seq 872 aa AA seqDB search
MAKKATQIEDVDTLLKRLEEMREAQAEFATFTQEQVDKIFYEAALAAEKNRISLARMAVE
ETGMGVMEDKVIKNHYAAEYIYNKYKDMKTCGVVEDDPAAGYRVVAEPMGIVAAVIPTTN
PTSTAIFKTLLALKTRNAIIISPHPRAKECTIAAARIVRDAAEKAGCPKGIIDWVPAPTI
DMTAAVMSNADIILATGGPGMVNAAYSSGKPALGVGPGNTPAIIDDTADIKLAVSSIIHS
KTFDNGMICASEQSVTVLDGVYDQVKKEFADRGCYFLQGKELDAVRKTVIVNGAVNAAIV
GKSAHFIAKTAGVDVPEKTKILIGEVTSVEPSEEMAHEKLSPVLGMYRAKNFDEAIAKAE
RLVADGGYGHTSSLYVNINEKEKIAKHQEAMKTCRILINTPSSQGGIGDLYNFKMAPSLT
LGCGTWGGNSVSGNVGPQHLLNYKSVAERQENMLWLRVPEKVYFKRGCMPVALRELKEVY
NKKRVFIVTDQFLYKSGFTKTIEETLDSLGIVHSSFWDVAPDPTLQCALEGVARIRSFEP
DCIIAIGGGSAMDAGKIMWSMYENPEEKFEDMAADFLDIRKRVYNYPKMGNKAFFVAIPT
SSGTGSEVTPFAIITDADNGVKYPLADYELLPNMAIVDTDNMMSQPKGLTSASGIDVLTH
CLEAFVSMMASDYTDGMALRGMKLVFEYLPRAYDNPNDVEARDHMANASCLGGLAFANAF
LGVNHSMAHKLGAFHHIPHGWANAVILTRVMRYNAAERPTKMGTFPQYDHPHTLARYAEA
GRFCGVTGKDDREVFENFVKKIEELKAYIGVKETIKDYGVDEKYFLDTLDQMSEQAFDDQ
CTGANPRYPLVSELRELYLDAYYGREPSFYED
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaggctactcaaattgaggatgttgatactttgctcaagcgcctcgaagaa
atgcgcgaggcacaggcagagtttgcaacattcactcaggagcaggtcgataagattttc
tatgaagctgctcttgcggccgagaaaaatcgtatctctcttgctcgcatggcagttgaa
gagactggcatgggtgtaatggaagataaggttatcaagaaccattacgcagcagagtat
atttacaacaagtacaaggacatgaagacctgtggtgttgtagaggatgatccagctgca
ggttatcgagttgtagccgagccaatgggcattgtagctgcagttattccaactactaac
ccaacttctaccgcaatctttaagacacttcttgctctgaagacaagaaacgccattatt
atttccccacaccctcgtgcaaaagagtgcactattgctgctgctcgtattgttcgtgat
gctgccgagaaggccggctgccccaagggtattatcgactgggtaccagctcctaccatt
gatatgactgcagcagtcatgagcaacgctgatatcatcttggcaaccggtggtccaggt
atggtcaacgcagcatattcttctggtaagccagctttgggtgttggtcctggtaacact
cctgctatcatcgacgataccgcagatatcaagcttgcagttagctccatcattcactct
aagacgtttgacaacggtatgatttgtgcttctgagcagtccgttactgttcttgacggc
gtgtatgaccaggtcaagaaggagttcgctgatcgcggttgctacttccttcagggtaaa
gagcttgacgctgttcgtaagaccgtcattgttaacggtgctgttaacgcagctattgtt
ggtaagtctgctcacttcattgcaaagaccgctggcgtcgatgtcccagagaagaccaag
attcttattggtgaggtaacctctgttgagccttcagaagagatggctcacgagaaactt
tctccagttcttggtatgtatcgcgcaaagaactttgacgaggcaattgctaaggctgag
cgtcttgttgctgatggcggctacggtcacaccagctctctttacgtcaacatcaacgag
aaagagaagattgctaagcatcaggaggcaatgaagacctgtcgtattctgatcaataca
ccttcctctcaaggcggtattggagacctctacaacttcaagatggctccatccctaacc
cttggctgcggaacctggggcggcaattccgtctccggcaacgttggcccacagcacctg
cttaactacaagtctgttgcagagaggcaagagaatatgctttggcttcgtgtacctgag
aaggtctacttcaagaggggctgcatgcctgttgctcttcgtgaactcaaagaggtctat
aacaagaagcgcgtcttcattgtcactgaccagttcctttataagagtggcttcactaag
actatcgaggaaaccctggattccctgggcatcgttcactcttcattctgggacgttgct
ccagatccaacccttcagtgtgctcttgagggcgtagctcgcattcgctcctttgagcca
gactgcatcattgcaatcggtggcggttctgctatggacgcaggtaagattatgtggtcc
atgtacgagaacccagaagagaagtttgaagacatggcagcagacttcttggatattcgt
aagcgtgtttacaactatcctaagatgggcaacaaggcattctttgttgcaattccaacc
tcttctggtaccggttctgaggtaactccatttgctatcatcaccgatgccgacaatggt
gttaagtacccacttgcagactatgagctgctgcctaacatggcaattgttgatactgat
aacatgatgagccagcctaagggtctgacctctgcttctggtatcgatgttcttactcac
tgtcttgaggcatttgtctccatgatggcatctgattacacagacggtatggcccttcgc
ggtatgaaattggtctttgagtacctgccacgtgcttatgacaatccaaacgatgttgaa
gcgcgcgatcacatggcaaacgcttcttgcctgggtggtcttgcatttgctaacgcattc
ttgggtgtcaaccactccatggctcacaagctgggtgctttccaccacatcccacatggt
tgggctaacgcagttatccttactcgcgttatgcgttataacgcagctgagcgcccaaca
aaaatgggtaccttcccacagtatgatcatccacacactcttgctcgttatgctgaggca
ggtcgtttctgcggcgttaccggcaaggatgatcgtgaggtctttgagaacttcgtcaag
aagattgaggagctcaaggcatacattggtgttaaggaaactatcaaggattacggcgta
gatgaaaagtacttcctcgacactcttgaccagatgtctgagcaggcatttgatgaccag
tgcactggtgcaaacccacgctacccacttgtctccgagcttcgcgagctctacttggat
gcttactacggtcgcgagccaagcttctacgaggattaa

DBGET integrated database retrieval system