KEGG   Atopobium parvulum: Apar_0894Help
Entry
Apar_0894         CDS       T00983                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
apv  Atopobium parvulum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Apar_0894
Enzymes [BR:apv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Apar_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(999463..1000095)
Genome map
AA seq 210 aa AA seqDB search
MIVQLTGTLVSVTPSVAVLDVNGVGYELGISASTAAALPQAGEAGVTVLTRMVVREDSME
LFGFASREERALFDRLRAISGVGPKLALSVLSTFTPQQLAVIVATNDGNRLKSVSGLGKK
KAERLIIELSDVFAKDTELKQLVGLTSPTDFASIPKPTVTSVESEAIEALLGMGFTSQEA
TLALEGYEEVGAITIEAAIGYALRRLGSGN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgattgtccagcttacgggcacacttgtatccgttactccttcagtcgctgttctcgat
gttaatggtgttgggtatgagctaggtatatcagcctcaacagctgctgcgcttccacaa
gcgggcgaggcgggcgttacggttttaacgcgtatggttgttagagaagactcaatggaa
ctctttggttttgcttcgcgagaagagcgtgcactctttgatcgcttacgtgcaatttct
ggagttggtcctaaactagctctttctgttctttctacgtttactccgcagcagcttgca
gtaattgtggctactaacgatggtaatcgccttaagagtgtctctggtcttggtaagaaa
aaagcagaacgcttgattattgaactatctgatgtgtttgcaaaagatacagagcttaaa
cagcttgttggacttacctctcctacagattttgcttctattccaaaacctactgtaact
tcagtagaatcagaggctattgaggctctccttggaatgggctttacttctcaggaggca
acgcttgctcttgagggttatgaagaggttggtgctattacaattgaagctgctattgga
tatgcattaaggcgtttgggaagtggtaattaa

DBGET integrated database retrieval system