KEGG   Atopobium parvulum: Apar_0906Help
Entry
Apar_0906         CDS       T00983                                 

Definition
Histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
apv  Atopobium parvulum
Brite
Enzymes [BR:apv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Apar_0906
Transfer RNA biogenesis [BR:apv03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Apar_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1013945..1015798
Genome map
AA seq 617 aa AA seqDB search
MNELILDILQQLRNGSQGALDAHQLEILINSHNSGIDSSAHSTEREKLIPKRAILPYFLQ
VKQKNNELWQSWNVTPELEERFIRSVRMKPRRTASGVATITVITRPHTCSSNCIYCPCDL
RMPKSYLANEPACQRAELTFFDPYVQVAARLQALHQMGHSTDKVELIVLGGTWSDYPESY
QYWFIKELFRALNEWPNSPSHIQERLDWYSSFGLQNSEEALSSFVAEQQAAVFDDAVTYN
QAFHKLYDSSRPHQRTWSQMQSTYDELVEQQRVNETAAARVVGLVIETRPDTITPGNLRM
FRQLGCTKIQIGIQSTRQEILDANKRQMSVAQIKRAFSLIRLYGFKIHSHLMVNLLGATP
EADKQDFKTFVTDPGFLPDEIKLYPCALVSGTQLVQKFHEGTWQPYTKDALVDVLVQDVL
NTPPYVRISRMIRDISATDILVGNKHTNLRQMVEQELAAEDVASRVQEIRFREINQQQVR
ANELTLQDFVYTTSVSNEHFLQWVTTDNKIAGFCRLSLPHWDKLISGTCDVSADELLVQP
GQAMIRELHVYGQALSLGSEGMSAQHQGLGQKLLAKASSIAADEGYTSLNVISSIGTRAY
YRTQGFTDAGLYQQKAL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaactcattttggacatattgcagcagctcagaaatggctcacaaggtgctctt
gatgcgcatcagcttgagatacttattaactcgcataacagcggaattgactccagcgcc
cacagtacagagcgcgagaaactcattcctaaacgagcaattctcccctattttttgcaa
gtaaagcaaaaaaacaatgaactgtggcaatcatggaatgtaacacctgagctagaagaa
aggtttatccgctctgttcgcatgaagcctcgtcgcaccgcttctggtgttgccaccatt
accgtaatcaccaggccgcatacctgctcaagcaattgcatttattgcccatgcgatctg
cgtatgcctaagagctaccttgctaacgaacccgcctgtcagcgtgctgagcttacgttt
tttgatccatacgtacaagttgctgctcgtcttcaggcactccaccagatgggtcactca
accgataaagtggagcttattgtgcttggtggtacctggagcgattatccagagagttac
cagtactggtttatcaaagagctcttccgtgcgctcaatgaatggcccaactctcctagc
cacatccaggagcgccttgattggtactcctcgtttggcttgcagaactctgaagaggca
ctctcttcctttgttgctgaacagcaagcggctgtctttgatgatgctgtcacgtataac
caggcttttcataagctctacgattccagccgtcctcaccaaagaacctggtctcagatg
caaagcacctatgatgagttggtagagcagcaacgcgttaatgagacggccgctgcccgt
gtggtaggtcttgttattgaaaccaggcccgataccatcacgccaggtaacctacgcatg
tttagacagcttggatgcaccaaaattcaaattggcattcagagcacgcgtcaagaaatt
cttgacgcaaacaaacgtcagatgagcgttgctcagattaaacgagctttctcactcatt
cgcttgtacggatttaaaatccactctcacctaatggtgaatcttcttggcgcaactcct
gaagcagacaaacaggactttaaaacgtttgtcacggatccaggatttctccccgatgag
atcaaactgtatccgtgcgctctagtatctggaacacaactggtgcagaagtttcatgaa
ggtacctggcaaccatacacaaaagacgcgctggtagatgtacttgttcaagatgtgctt
aacacaccaccgtatgtacgcatttctcgcatgattagagacattagcgcaaccgacatc
ttagtaggaaacaaacacaccaacctacgtcaaatggtggaacaagaacttgctgctgaa
gacgttgcaagccgcgtacaggaaattcgctttagagaaattaaccagcagcaggtacgc
gccaatgaactcacactgcaagactttgtctacaccacctcagttagtaacgagcacttc
ctgcaatgggtgactactgacaataaaattgcaggtttctgtaggctttcacttccccac
tgggacaaactgatctctggcacatgtgatgttagtgccgatgagttgctggtacagcca
ggtcaagccatgattagagagcttcacgtatacggacaggcattatccctaggctcggaa
ggaatgtctgcccagcaccagggtctaggtcaaaaacttcttgccaaagcttcctctatc
gcagctgatgagggatataccagtcttaatgttatcagctcaattggaacacgcgcctac
tatcgcacgcagggctttactgatgctggcctctaccaacaaaaagccttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system