KEGG   Atopobium parvulum: Apar_0922Help
Entry
Apar_0922         CDS       T00983                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apv  Atopobium parvulum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Apar_0922
   01230 Biosynthesis of amino acids
    Apar_0922
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Apar_0922
   00051 Fructose and mannose metabolism
    Apar_0922
   00562 Inositol phosphate metabolism
    Apar_0922
Enzymes [BR:apv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Apar_0922
Exosome [BR:apv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Apar_0922
  Exosomal proteins of bladder cancer cells
   Apar_0922
  Exosomal proteins of melanoma cells
   Apar_0922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1035193..1035960)
Genome map
AA seq 255 aa AA seqDB search
MRNRMIAGNWKMNETFAEGIELAQGIVDQLASGTGNVDVVVAPPLVDLKGVSEVLTQANS
SVALSAQNVYWEESGAFTGETSPAMLTSVGATYCIIGHSERRGYFGETDEDINRKAKALM
AHDIVPISCCGESLEVRNAGTHVQFVVDQIKADTKGLEITDPSKYVIAYEPIWAIGTGMT
ATADDAQEVCGAIRKTLVEIFGAEIAEGIRILYGGSAKPENVGGFLEKEDVDGALVGGAS
LKADSFVAMVKSAMN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcgtatgattgcaggtaactggaagatgaatgagaccttcgctgagggcatt
gagcttgctcagggaatcgtcgatcagcttgcttccggtaccggaaacgttgacgttgtt
gttgctccacctcttgtagaccttaagggtgtctccgaggttcttactcaggcaaactct
tctgttgctctttctgcacaaaatgtgtattgggaggagtctggcgcatttactggtgaa
acctctccagcaatgctgacttctgttggtgcaacatactgcatcattggtcactctgag
cgtcgcggttactttggtgagaccgacgaggacattaaccgcaaggcaaaggcactgatg
gctcatgacatcgttcctatttcttgctgcggtgagtctcttgaggtccgtaatgctggc
actcacgttcagtttgttgttgatcagattaaggcagacaccaagggtcttgagattacc
gatccttccaagtacgtaattgcttatgagccaatctgggcaattggtactggtatgact
gcaactgctgatgacgcacaggaagtttgcggcgcaatccgtaagaccctggtagagatc
tttggcgcagaaattgcagagggcatccgtattctttacggtggctctgcaaagccagag
aacgttggtggcttcctcgagaaagaggacgtcgacggcgcacttgttggtggcgcatct
cttaaggctgattcttttgttgcaatggtaaagagcgctatgaactaa

DBGET integrated database retrieval system