KEGG   Atopobium parvulum: Apar_0968Help
Entry
Apar_0968         CDS       T00983                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
apv  Atopobium parvulum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Apar_0968
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Apar_0968
Enzymes [BR:apv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Apar_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093052..1093606
Genome map
AA seq 184 aa AA seqDB search
MANTNIYDLSVEERDGSLTSLSSFDGKVLLIVNTATGCGFTPQYEDLERIYATYKDQGFE
ILDFPCNQFAGQAPESDEEIHQFCTMKFGTNFPQFKKSDVNGETANPLFERLATAFPFQG
FGKGIKALALDKFAKANNKKFGNKAYIMWNFTKFLVDRQGNVVARFEPTADMAEVETAIK
NLLA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataccaacatctatgacctctctgtagaagagcgcgacggatctcttacttcc
ctctcatcttttgacggaaaagttcttctgattgtcaacactgcaactggctgcggtttt
accccacagtatgaagatcttgaacgaatttacgctacttataaagatcaaggctttgag
attttggacttcccttgtaatcagtttgcaggccaggctccagagtccgatgaagaaatt
caccagttctgcactatgaagtttggtaccaattttccacagttcaagaaaagtgatgtc
aacggagagaccgcaaatcctctctttgagcgtcttgcaacagcttttcctttccagggc
tttggtaagggcatcaaggcacttgcactggacaaatttgcaaaagcaaacaacaaaaag
tttggcaacaaagcctacatcatgtggaacttcaccaagttccttgtagaccgccaagga
aacgttgttgcccgctttgagccaaccgccgatatggcagaggttgagaccgcaattaaa
aaccttcttgcataa

DBGET integrated database retrieval system