KEGG   Atopobium parvulum: Apar_1046Help
Entry
Apar_1046         CDS       T00983                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
apv  Atopobium parvulum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Apar_1046
Enzymes [BR:apv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Apar_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1182660..1186097)
Genome map
AA seq 1145 aa AA seqDB search
MQAFHNTSNIVCRDPKGAAELGTSVTIRIFAWDDDVQSVTLRLWQEYGPESSLEAPTLSG
EKCVVMQKSVFAETLPAGVPDYAQCFEAIIKPAATGLIWYRFELQASDGAVWLYGAQENR
CTGVGGFAYGEPPSFQITCYEPRTSVFGVEDPSWYKGGVVYQIFPDRFARDANWRERTMQ
ALAVPRNGVSRQLVEDWEKVPEYQRDANGRVTEWDFYGGSLVGIEEKLPYLEDLGITALY
LNPIYAASSNHRYDIADYLEVDPVLGTVEDFEHLCVKAAEHGISIILDGVFNHCGADSKY
FNKFSNYPEPGAVQQAGSVYDEWFTLHEDGTYESWWGVDALPTIVSDNPTYQEFICSENG
VIRTWLRRGARGWRLDVADEISDSFIQKIRAAALAERSDAVIIGEVWEDASNKRAYGKLR
HYLEGFELDGPMNYPLRKAILSFLMNEAGAEATVSALEELWENYPHEAFYSCLNVFGTHD
KERLINVVADAPTPDSLSAHEQVTYRLSADQRGLSKARMWQAAVLQMTLPGVPSIYYGDE
MGVEGFVDPTNRATMPWPGTSPRADLDYFHIYRNAIALRKTLPLLVNGSFEPFVPEDGSN
DVLAFWRRPLQKDDCLQQQGEFTPGICVLVNKSRSDAKTVYVSVPQNMQVIDVISGQAVP
VKDGKAEVFLWQLGCTVLNVQPTHRLQKSLEPGMGVLAHITSLPANDGDVTKPGQRLGVI
GRETFEFIDFLAKSGQKYWQILPVSPTDEYGSPYAGISAFAGNINLLDPAAMEKVILECD
DSQGERAAEYQAFLARNSYWLDSYAAFRAIKDLLGEGMWQEWPEQYRSWSQELFTRPELV
HAIELHRKYQFAFDVIWSQTLAEAHAKGIQIIGDMPMFVSEDSADVWAHPELFALDATGH
TELQAGAPADAFSQDGQLWGNPTYNWQAHKDEEYCWWIERFRRSFYLYDYTRLDHFIGFT
SYYAIEQGKTATRGSFKFGPGYELFDVAYKQLGPLPFIAEDLGAVTPAVRALLSQTGFPG
MSVIQFADGDCRYSFAPAQESIVYSGTHDTQTLMGFVEDRFTGGQATDESQQIFNHLMEQ
IVDTSNAVVILPLQDVLCLSDNARMNIPGKTEGNWSWQVKKDMITPEVIQRLQRYVELHQ
NRRNA
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcttttcataacacctcaaacattgtttgtagagatccaaaaggcgcagcagaa
ctaggcacttcagtaacaatcagaatatttgcttgggacgatgatgttcaatcagtaacg
cttcgtctatggcaagaatatggtcctgaatcatctttagaggccccaactctatctggc
gagaaatgcgttgtgatgcaaaagagtgtttttgctgaaacgcttccagctggtgtaccc
gattatgcacagtgctttgaggctattatcaaacctgctgctacaggccttatttggtat
cgttttgagctgcaagcttctgacggagcagtctggttgtatggtgctcaagaaaatagg
tgcacaggtgttggtggttttgcctatggtgagccaccatcatttcagattacctgctac
gagcctcgtaccagcgtttttggtgttgaagatccaagctggtacaaagggggagttgtc
taccagatttttcctgacaggtttgcacgagatgcaaattggcgcgaacgtaccatgcaa
gcacttgctgttccaagaaatggagtttctcgccagttggttgaagactgggagaaagtc
ccggagtatcaaagagacgctaatggtcgcgtgaccgagtgggatttctacggcggatct
ttggttggcattgaagagaaactgccctatttggaagacctaggaataactgcgctttat
ttgaatcctatttacgctgcttctagtaatcatcgctacgatattgcggattatttggaa
gttgaccctgttttgggcaccgtagaagactttgagcacctctgtgttaaagcggctgag
catggtatttctattatcttggatggcgtatttaaccactgtggtgctgactcaaaatat
tttaataaattttctaattaccccgaaccaggagcagttcaacaggcaggttcggtctat
gatgagtggtttacgcttcatgaggatggaacgtatgaaagttggtggggtgttgacgcg
cttccaactattgtgtctgataaccctacttaccaggagtttatttgtagtgagaatggt
gttattagaacatggctacgtcgtggcgctcgcggttggcgcttagacgttgcagatgag
atttctgattcatttattcagaagattcgtgcagctgcactcgcagagcgcagcgatgcg
gttattattggagaagtctgggaggatgcaagtaataagcgtgcctatggaaaacttagg
cattatcttgagggttttgagcttgacggccctatgaattatcctctgagaaaagctatt
ctttcatttttgatgaatgaggctggtgctgaggcaactgtttcagctcttgaggagctt
tgggaaaactatcctcacgaggcgttttattcttgtctaaatgtgtttggaacgcatgat
aaggaacgtttaattaatgtagttgcggatgctcccacgcctgattctctttctgctcat
gagcaggtgacgtatagactttctgctgatcagcgaggtctttctaaggctcgtatgtgg
caggcggcggtgctccagatgacacttcctggtgttccttctatttattacggcgatgag
atgggtgttgagggatttgttgatccaacaaatcgcgcgacaatgccatggcctggaacc
agtcctcgtgcagatttagattactttcacatttatcgcaatgctattgcgcttagaaaa
acgctaccactactggtaaacggctcgtttgaaccgtttgttccagaagatggatctaat
gatgttttggctttctggcgtaggcctcttcagaaagatgattgtttacagcagcagggt
gagtttacgcctggcatttgtgttctggtaaataagagccgctcagatgctaaaacagta
tatgtttctgtacctcaaaatatgcaggttattgacgttattagtggccaagcggtacct
gtcaaagatggtaaagcagaggtctttttatggcagcttggatgtaccgttttaaacgta
cagccgacccacaggttacaaaagtctcttgagcctggtatgggcgtgctcgctcatatt
acttctctgcccgccaatgatggagatgtgactaaaccgggacagagacttggtgttatt
ggtcgtgaaaccttcgagttcattgattttctcgccaaatctggtcaaaagtactggcag
attttgcctgtcagtccaaccgatgaatatggctctccttatgcgggaatttccgctttt
gcaggaaacattaatttgctcgatccagctgcaatggagaaagtcattcttgagtgcgac
gactctcagggtgagcgcgctgctgagtaccaggcatttctggcgagaaactcgtattgg
cttgattcgtatgcggcttttcgcgctattaaagatcttcttggtgaggggatgtggcag
gagtggcctgaacagtatcgtagctggtcacaagagttgtttacacgtcctgagcttgtt
catgcaattgagcttcatcggaagtaccaatttgcttttgatgtcatttggagtcagact
ttagcggaagcgcatgctaagggtattcagattattggtgacatgcccatgtttgtttcg
gaagattccgccgatgtttgggcacatccagagctttttgctttagatgctacaggccat
acagagcttcaagctggtgctccagctgatgctttttcgcaagatggtcagctgtggggt
aatccaacatataactggcaagctcataaagacgaggaatattgttggtggattgagcga
ttccgcaggtctttctatctatacgactatacaaggctcgatcactttattggctttacg
tcttactatgctattgagcaaggaaaaactgcaactagaggttcatttaagtttggacct
ggctatgagttgtttgatgttgcttataaacagcttggtccacttccttttattgccgag
gatttgggagcagttactcctgctgttagagcactgctctctcagacgggatttcctggc
atgagcgtcattcagtttgctgacggagactgcagatattcctttgcaccagctcaggag
tctattgtgtacagtggtacacatgatacccaaacgcttatgggttttgtagaagatcgc
tttacaggcggccaggcaactgatgaatcacaacagatttttaatcatcttatggagcag
atagttgatacctctaatgcagtagttatcctgccgcttcaggatgttttgtgcctttcc
gacaatgctcgtatgaacattcctggtaagactgaaggcaattggtcttggcaggttaaa
aaggatatgattacgccagaggttattcaaaggctacagaggtatgtagaactgcatcag
aacagacgcaacgcttaa

DBGET integrated database retrieval system