KEGG   Atopobium parvulum: Apar_1051Help
Entry
Apar_1051         CDS       T00983                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
apv  Atopobium parvulum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Apar_1051
Enzymes [BR:apv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Apar_1051
Exosome [BR:apv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Apar_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1192345..1194357)
Genome map
AA seq 670 aa AA seqDB search
MAELNASLAVSDQDAYLFAQGTWFQSHKKLGAHPAVQEDGIEGYHFAVWAPNAVSVSVVG
DFNNWDDTVNVLSRSKHGGIWEGFVPGITSEVLYKFLIVSTSGEKIFKADPYATYAEVRP
HTASITFDPDVYVWEDDVWMKKRATLKFLHSPLNIFEVHLGSWKQHTDSSAQEDSANAET
TEKIEEPKDYFDTNVDAFYTYDDLSKELVAYVKEMGYTHIELLPVMEHPFDGSWGYQVTG
YFAPTSRYGNPAQFKHFIDSCHQAGIGVILDWVPGGFCKDAHGLAEFDGTKLFEEKEHPN
WGTLKFDLTRGEVRSFLVSNLLMWLKDYHADGIRVDGVSSMLYLNFGIDDPSQKRFNCKG
TEEDLDASAFLRLCNETAQKQYPDILMIAEESTAWPLVTYPPDVGGLGFNLKWDMGWMND
TLHYCQTDFPYRPGNHRLLTFSSMYQFNENFVLPLSHDEVVHGKCSLIQRMPGDWWRQFA
GMRALALHQMTHPGAKLNFMGNEIAQFIEWRYYEGIEYYLTEEYPTHAHQQAYIKALNHF
YKNHPGLWQYAYDNRGFDWIDADNNEQSIISFVRHGRKPSEDLVILINFDVATHQNFRLG
MPSEGVWKEVFNSDAKEFGGSGVVNSKKLSTKPVAWNGRDYSVELSVPPLGGIVLAFEKE
LPKRGKHGRK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcagagttaaatgcatcgttagcagtgagtgaccaggatgcatacttgtttgcgcaa
ggaacatggtttcagagccataaaaaactaggtgcgcaccctgcggtccaagaagatgga
attgagggctatcattttgctgtttgggcacccaatgcagtttctgtttctgttgttgga
gactttaataattgggatgataccgtcaacgttctatctcgctcaaaacacggtggaatc
tgggaaggttttgttccaggaataacctcagaagtattgtataaatttctgattgtatcc
acatctggcgagaagattttcaaggctgacccgtatgctacctatgcagaggttagacca
catacggcatctattacgtttgacccggatgtgtacgtttgggaagacgatgtatggatg
aagaaacgtgcaacgcttaagtttctacatagtcctctcaacatttttgaagttcacctt
ggtagctggaagcagcatactgactcgtctgctcaagaagattctgctaatgcagagact
actgaaaagattgaagaacctaaagattattttgatacaaacgtagacgcgttctacacc
tatgatgacctgtcaaaagagttggtagcttacgttaaagagatgggctacacccatatt
gagcttctccccgttatggagcacccctttgatggatcctggggctatcaggtaactggc
tattttgctcccacctcaaggtatggtaatcctgctcagttcaagcactttattgactcc
tgccatcaggctggtatcggcgtcattttagactgggttccaggaggtttctgcaaagat
gctcatggtcttgcagagtttgatggcaccaaactttttgaagaaaaagagcatcctaac
tggggaactcttaagtttgaccttactcgtggtgaggttagaagcttccttgtttctaac
ctgcttatgtggttgaaggattatcacgctgatggcattcgtgttgacggtgtcagtagc
atgttgtatttgaattttggcatcgatgacccttctcagaagcgctttaattgcaagggt
actgaggaagatttggatgcaagcgctttcttgcgtctctgcaatgagaccgctcaaaag
cagtatcctgatattttgatgattgcagaagagtccacggcatggccgctggttacctat
cctccagatgttgggggacttggtttcaaccttaagtgggacatgggttggatgaacgat
acgttgcactattgtcagactgattttccttatagaccaggcaatcatcgacttttaacc
ttctccagcatgtatcagttcaatgagaactttgtgctgccactgagccatgatgaagtt
gttcatggtaagtgcagccttattcagcgtatgccaggagattggtggagacagtttgct
ggtatgagagctctagcgctccatcagatgacccatccaggtgctaagctcaactttatg
ggcaacgagattgcacagtttattgagtggcgctattacgagggcattgagtattacttg
actgaggagtatccaactcatgctcaccagcaggcatatattaaggctcttaatcatttc
tataagaatcatccaggactttggcagtacgcctatgacaaccgtggatttgattggatt
gatgcagataataatgagcaatcaatcatttcgtttgttcgccatggaagaaagccttcc
gaggacctggttattctcatcaattttgacgttgcaacccatcagaacttccgtttaggt
atgccttctgaaggtgtgtggaaagaagtatttaattccgacgcaaaagagtttggcggt
tcgggtgttgtgaatagtaagaaactttccactaaaccagtggcatggaatggaagagat
tattcggtagaactgtctgttcctccgcttggtggcattgttttagcgtttgagaaagaa
cttccaaagagggggaagcatggccgtaaataa

DBGET integrated database retrieval system