KEGG   Atopobium parvulum: Apar_1193Help
Entry
Apar_1193         CDS       T00983                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
apv  Atopobium parvulum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Apar_1193
Enzymes [BR:apv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Apar_1193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1336647..1337567)
Genome map
AA seq 306 aa AA seqDB search
MGKVIVFGSLNMDISIEVDKMPQQGETMGGKNLVTSPGGKGANQAVAAARMGADVHMIGA
VGADSFGQDLKQSLIGYGVNAEQVDELSGVSTGVAVIVRVGGDNRIILDHGANHARTVDD
VKAVLDCIAEPGDVFLTQFECELSSTFELIRYAHELGLYTMVNPSPAATMTIGLLASVDL
LCLNEIEFADLFGEGKISPLAEPEVAVQKVLASGVATAVLTLGSKGSIAADAQGVYQQEC
YRVDTVDTTCAGDTFMGTLAAFQASGQLQGQDIKQALDVAAKAAALATTKVGAQQSIPTY
QQVVDF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagtgattgtatttggaagcctgaacatggacatctctattgaggtggataag
atgcctcagcagggagaaaccatgggcggcaaaaatcttgtcacaagcccaggcggaaag
ggtgccaaccaagcagttgctgcagctcgaatgggtgcagatgttcacatgattggtgct
gttggtgctgattcgtttggacaggacctcaagcagtcgcttattggctacggtgtcaat
gcggagcaggtagatgagctgtctggagtctccactggtgttgccgtaatcgtgcgtgtt
ggcggcgacaatcgcatcattttggaccacggcgctaatcatgcacgcacagttgacgac
gtaaaagcagtgctcgattgcattgcagagccaggtgacgtgttcttgacacagtttgag
tgcgagttgtcgagcacgtttgagcttattaggtacgcgcatgagctggggctctatacg
atggtgaacccatcgccagcggctaccatgaccatcggtcttctcgccagcgtggacttg
ctctgcctgaacgagattgagtttgcggacctgtttggtgagggcaagatcagcccactg
gcagagccagaggtcgcggtgcagaaggtgcttgcaagtggcgtggcaactgcggtgttg
acactggggtccaagggttcgattgctgctgatgcacaaggcgtttaccagcaggaatgc
tatcgcgtggataccgttgacactacctgtgcaggagatacgtttatgggtacactcgcc
gcgtttcaggcgtcgggacagttgcagggtcaagatatcaagcaggctcttgacgtggct
gcgaaggctgcagcgcttgctactactaaggttggcgctcagcaatcaattccaacgtat
cagcaggtagttgacttttag

DBGET integrated database retrieval system