KEGG   Atopobium parvulum: Apar_1252Help
Entry
Apar_1252         CDS       T00983                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
apv  Atopobium parvulum
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Apar_1252
Enzymes [BR:apv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     Apar_1252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1401364..1402302
Genome map
AA seq 312 aa AA seqDB search
MPSIYTVTLNPALDKTVHVQNFTFDQVNRINWLRRDAGGKGINVSKVIAKLGGESTAIAV
LAGQTGQWIANALDENNIKVHAITVPGETRTNLKVVDAEGGTNTDINEPGPEVTDSILDQ
ALVDVVSKTSAGDIVVLSGSLPRGASTNTYGRWTRALRDAGLKVYLDADGAALSAGLEQK
PYFTKPNDHELSAMLGRELTDVNAIATAASEIVAGGIDTVCVSMGGNGAVYATTNEVWYA
GPVKVKVGSTVGAGDSVVAAFAFADAQGLSTEDALRLAMATGAANVMESGTQAAERSVVD
SLIKKVQFTRLR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcatctatactgttacgctcaaccctgctctagacaagactgttcatgttcaa
aactttacatttgaccaggtaaaccgtatcaactggctcagacgagacgctggtggtaag
ggtattaacgtctccaaagtcattgcaaaacttggtggagagtcaactgccattgctgtt
ctcgctggccaaaccggacaatggattgcaaacgctcttgacgagaataacatcaaggtc
catgcaattactgttcctggagaaacgcgcaccaatcttaaggttgttgatgccgagggc
ggcaccaataccgacatcaacgaacctggccccgaggtcaccgacagcatacttgaccag
gcacttgttgatgttgtctccaagacttccgctggcgatatcgtagttctttctggcagc
ctcccccgcggagcttccactaacacatacggtcgttggacgcgtgctctacgtgacgcc
gggctgaaggtttatctggacgccgatggtgcagcgctttcagcaggtcttgagcagaaa
ccatacttcaccaagccaaatgatcatgagctctccgccatgctgggccgtgagcttacc
gacgtgaacgcgattgccacagccgcatccgagattgtcgctggcggcatcgacactgtc
tgcgtttctatgggaggcaacggtgccgtctatgctacgaccaacgaagtttggtatgca
ggtccagtaaaagtcaaggtaggaagcactgtcggtgccggtgactccgttgtggcagcg
ttcgcctttgcagatgcacagggtctctcgacagaagacgcactgcgactggccatggcc
acgggtgctgcaaacgtcatggagagcggaactcaagcggcagagcgctcggttgtggat
tcgcttatcaagaaagtccagttcacgcgcctgcgctag

DBGET integrated database retrieval system