KEGG   Atopobium parvulum: Apar_1293Help
Entry
Apar_1293         CDS       T00983                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
apv  Atopobium parvulum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Apar_1293
   00052 Galactose metabolism
    Apar_1293
   00500 Starch and sucrose metabolism
    Apar_1293
   00520 Amino sugar and nucleotide sugar metabolism
    Apar_1293
Enzymes [BR:apv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Apar_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1460542..1461435)
Genome map
AA seq 297 aa AA seqDB search
MKAIIPAAGLGTRFLPATKVTPKELLPVLDKPVIQYVVEEALEPEEVDEVIIINSREKPQ
VETYFAEDQKFESDLSSRGKQDLADKVHAASALPVSFTYQDNPRGLGHAVLCAADGVGDE
PFFVLLGDYFVPDRQMCIRMAEISKQYNNASVIAVAPVPADQVYRYGIIAGECISSPSDN
AEGEGAIWKVTGLVEKPRPEDAPSHLFIVGRYLLSPKIMELLATQGPGAGNEIQLTDAME
RLLAEEEMYALVIDPEEGCDTGTPAAWAATNARMALSDQDSAAAFKEALGSYANRIG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaattatcccagcagcaggtctaggtacgcgttttttacctgcgacaaaggta
actcctaaagagctgttgcctgttttggataagcccgttattcagtacgtagtagaagag
gctcttgagccagaagaggtcgatgaagtaatcatcatcaattctcgtgagaaaccacag
gttgaaacctactttgctgaagatcagaagtttgagtccgatctttcttctcgcggaaag
caagaccttgccgataaagttcatgcagcttctgcgcttcctgtttcttttacctatcag
gacaatcctcgtggccttggccatgcagtgctttgcgctgcagacggcgtaggagacgag
ccattttttgttcttctcggtgattattttgttccagaccgtcagatgtgcattcgaatg
gcagagatttctaagcagtataacaacgcttccgtcattgcggttgccccagttcccgca
gatcaagtgtatcgttacggtattatcgcgggcgagtgcatttcttctccttcagataat
gctgagggtgagggtgctatttggaaggtaaccggacttgtcgagaaaccccgtccagaa
gacgcaccttctcacctgtttattgttggccgttacttgctctctccaaagattatggag
cttctggcaactcagggtcctggtgcaggtaacgagattcagttgacagacgcaatggag
cgcctgcttgctgaggaagaaatgtacgcgctggtaattgatccagaagagggttgcgat
accggtactcctgcagcttgggcagcaactaatgctcgtatggcactctctgaccaggat
tctgcagcggcgtttaaagaggcgctcggcagctatgccaaccgcattggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system