KEGG   Atopobium parvulum: Apar_1296Help
Entry
Apar_1296         CDS       T00983                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
apv  Atopobium parvulum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Apar_1296
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Apar_1296
Enzymes [BR:apv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Apar_1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1463320..1464603)
Genome map
AA seq 427 aa AA seqDB search
MDVIKVVGGNSVTGEVTVEGAKNSALKLMAATIMAPGVTTLTNVPNIADVHVMGKVLKTL
GARIEVVGLHELKIDTTDITSWETPYSLVAQMRASTAVLGPLISRFGKAVVAMPGGCNIG
ARKIDMHILGLEALGVEFKVEHGNIHASAPHGVTGETVSLAFASVGATENLMMASVFAKG
VTVIDNAAREPEIVDLANMLNKMGANIQGAGSPVIEIHGVTELHPVEHEVVGDRIEAGTF
LAIGALTGEPITVHGFEPNHLGLVLKKYEQMGITVETGDRWARASRQQDLKAIDIQTLPF
PGFPTDMQAQTMTLLALAKGTCIITENVFENRFMLASELSRMGADITIEGHHAIVRGVSG
FEGAQVKSPDLRGGAALVMAGLVAEGETIVSDIHHIDRGYEGFVEKLVALGADAQRTTIP
DDDFIEG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcataaaagtagtgggtggcaactctgtcacaggagaggtcaccgtagagggc
gcaaaaaactctgccctcaaattgatggctgcaaccatcatggctcctggtgttactaca
cttaccaacgttcctaatattgcagacgttcacgtcatgggtaaggtactcaagacgtta
ggtgctcgtattgaagtcgttggtcttcacgaactcaaaattgataccacagatattaca
agctgggagactccttacagccttgttgcacaaatgcgtgcgtcaactgctgttttgggc
ccccttatctcacgttttggtaaagctgttgttgcgatgccaggcgggtgtaatatcggc
gcacgtaaaattgatatgcacattttgggtcttgaggctttgggcgtcgaatttaaggtt
gagcacggcaatattcatgcaagtgctcctcacggcgtaaccggagagactgtttctctt
gcttttgcttctgttggcgcaacagagaacctgatgatggcatcagtctttgcaaagggt
gtaacggtcatcgataacgcagcccgtgagccagaaattgtcgatctagctaacatgctc
aataaaatgggtgccaacattcagggcgctggatctcctgttattgagattcatggcgta
actgagctgcatcctgttgagcatgaagttgttggcgatcgtattgaggctggtactttc
ctggctatcggtgcgcttactggtgagcccattaccgttcacggcttcgagccaaatcac
cttggtctggtgcttaagaagtatgagcagatgggcattaccgttgagactggagatagg
tgggcacgggcttctcgccagcaagatcttaaggctatcgacattcagacgctgccgttt
ccaggcttcccaacggatatgcaggcacaaactatgacgctgcttgctctggcaaaggga
acctgtattattaccgagaatgtctttgagaaccgctttatgctagcgtccgagctttcc
cgtatgggagctgatatcactatcgagggacatcatgctattgttcgcggtgtctccggg
tttgagggagcacaggttaagtctccagatcttcgtggcggcgctgctcttgtcatggct
ggtcttgtggctgagggtgaaacaatcgtttccgatattcaccacattgaccgtggttac
gagggatttgtcgagaaactcgtcgcgctgggagcagatgctcagcgcactaccattcca
gacgacgattttatcgaaggatag

DBGET integrated database retrieval system