KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA07_12552Help
Entry
APA07_12552       CDS       T01818                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    APA07_12552
Enzymes [BR:apw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     APA07_12552
Exosome [BR:apw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APA07_12552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1313978..1315477)
Genome map
AA seq 499 aa AA seqDB search
MSKQDCVLAIDQGTTSTRSIVFDRDAQELAAAREEFAQHYPKAGWVEQCPEDIWKDVVST
ARAALEKSGAADRVAGIGITNQRETIVVWERATGKPIHRAIVWQDRRTANVCQKLRDEGA
ETLVRERTGLLIDPYFSATKLAWLLDNVPQARERAEKGELAFGTIDSFILWRLTGGKVHA
TDVTNASRTMLFDIHRQQWDEDLLRLFRVPAALLPEVKDSSCIYGETVPELFGRPIPIAG
IAGDQQAAVVGQACFTPGMAKATYGTGCFLLLNTGDKPVTSRNRMLTTIAYRINGKTTYA
LEGSIFVAGAAIKWLRDGLHLITHASQTDDMATRVPDSHGVYMVPGFVGLGAPHWDPDAR
GLICGLTLDSSAAHIARAALESVAYQTLDLVTAMMQDGGGTTDSIRVDGGMSANDWYCQF
LADMLQAKVERPRNVETTALGAGFLAGIATGVWDSEQTVASEWARGSLFEPKMENEQRRT
MIAGWHQAVKRTLSTYTGG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcaagactgtgtcctggctattgatcagggaacgacatcaacacgcagcatt
gtctttgatcgtgatgcgcaggaactcgctgccgccagagaggagtttgcacagcattac
cccaaggctggctgggtagaacaatgcccggaagatatctggaaagatgttgtaagcacc
gcgcgcgcagcgctggaaaaatctggcgcagcagaccgggttgcaggcattggcattacc
aaccagcgcgaaaccattgtggtgtgggaacgcgctaccggcaagcctatccatcgcgct
attgtctggcaggatcggcgcacggccaatgtgtgtcagaaactgcgggatgaaggcgca
gaaacactggtgcgcgaacgcaccggccttttgattgacccatatttttctgccaccaag
cttgcatggctgctggataacgtgcctcaggcccgcgaacgtgcagaaaagggtgaactt
gcttttggcaccattgattccttcattctgtggcgcctgacaggcggtaaggtgcatgca
acggatgtaaccaacgcatcccgcaccatgctgtttgatatccaccgccaacagtgggat
gaagaccttctgcgtcttttccgcgtacctgcggcacttctcccagaagtgaaggatagt
agctgcatttatggtgaaaccgtgccggaactgttcggtcggcctattcctattgcaggt
attgcgggggatcagcaggccgctgtagtggggcaagcatgttttacacccggcatggcc
aaggccacctacggcacaggctgctttttgctgctgaatacgggggataaacccgtaaca
tcacgcaaccgaatgctcaccaccatagcctatcgtatcaatggcaaaaccacctatgcg
ctggaaggctccatttttgtggccggtgcggccatcaaatggctgcgcgatgggctgcat
ctgattacccacgcctctcaaaccgatgatatggccacccgtgtgccagacagccacggt
gtatacatggtgccgggctttgtaggccttggcgccccacattgggacccggacgcacgc
gggcttatctgcggccttacgctggattcaagtgctgcgcatattgcccgtgcggctctg
gaatccgtggcatatcagacgctcgatctggtaaccgccatgatgcaggatggcggtggc
accacagatagcattcgcgtagatggcggcatgtctgccaatgactggtactgccagttt
cttgcagacatgctgcaggccaaggtggaacgcccgcgcaacgtggaaaccactgctctg
ggcgcaggctttctggcaggcatagcaacaggtgtgtgggatagtgagcagaccgtggct
tctgaatgggcacggggctctctgtttgaaccgaaaatggaaaatgaacagcgccgcacc
atgattgccggatggcatcaggctgttaagcgcaccctcagcacctatacgggcggctga

DBGET integrated database retrieval system