KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_03120Help
Entry
APA42C_03120      CDS       T01818                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APA42C_03120
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APA42C_03120
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APA42C_03120
Enzymes [BR:apw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APA42C_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
324890..325723
Genome map
AA seq 277 aa AA seqDB search
MSRIAARFKALAAQGRGALIPYLEAYDPDWDTSLELLRKMPAAGADLIEIGMPFSDPSAD
GPVIQAAARRGLKAGATLAGVLDMVTDFRQQDNETPIILMGYLNPVESYGYERFCRDAAS
AGVDGLILVDLPPEEADVLAPFAKANKLDIIRLVAPTTSDERLPYVLSHASGFVYYVSIT
GITGTRSATTHDLEAAIPRLRKVTKLPIAIGFGVRTPQQAANASSIADGAVVASALLSTL
AETLDDKGRATAETLPRVLAQIEDLAKAVRSANGKAV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtatagcagcccgttttaaagcacttgcggcccaaggccgcggcgcgcttatt
ccgtatctggaagcatatgatccggattgggatacatcgctcgaactgctacgcaaaatg
cccgctgctggcgcagatctgattgaaattggcatgcctttttcagatccctccgccgat
ggcccggttattcaggctgctgcccgccgtggccttaaagccggggccacgctggcaggt
gtgctggatatggtcacggacttccgccagcaggataacgaaacccccattatccttatg
ggctatctaaatccggtagaatcctatgggtatgaacgcttctgccgtgatgccgccagc
gctggtgtggacgggctgattctggtggatctgccgccagaggaagccgatgtgctggca
ccatttgccaaggccaacaagctggatatcatccggcttgtggcgcctaccacgtcggat
gaacgcctgccttatgtgctctctcacgcatctggctttgtgtattatgtcagcattacg
ggcattacgggcacacgttctgccactacgcatgatctggaagccgctattccacgtctg
cgtaaggttaccaaattgccgattgctattgggtttggtgtgcgtacgccgcaacaggcc
gccaatgcttccagcattgccgatggtgcagtcgtggcttcggccctgctttctactttg
gcggaaacgctggatgacaaaggccgcgctacggcagaaacgcttccgcgcgtgttggcg
cagattgaagatctggcaaaagccgtgcgtagcgctaacggaaaggcggtatga

DBGET integrated database retrieval system