KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_05960Help
Entry
APA42C_05960      CDS       T01818                                 

Definition
(GenBank) esterase/lipase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw00010  Glycolysis / Gluconeogenesis
apw00020  Citrate cycle (TCA cycle)
apw00620  Pyruvate metabolism
apw01100  Metabolic pathways
apw01110  Biosynthesis of secondary metabolites
apw01120  Microbial metabolism in diverse environments
apw01130  Biosynthesis of antibiotics
apw01200  Carbon metabolism
Module
apw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APA42C_05960
   00020 Citrate cycle (TCA cycle)
    APA42C_05960
   00620 Pyruvate metabolism
    APA42C_05960
Enzymes [BR:apw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     APA42C_05960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl DUF915 Esterase DUF676 Thioesterase Esterase_phd LIDHydrolase Ser_hydrolase Lipase_3 Ndr
Motif
Other DBs
NCBI-ProteinID: BAI17034
Position
614310..615476
Genome map
AA seq 388 aa AA seqDB search
MPNTITALTMPKFGLAMTEGKLASWTVPVDQSVQQGDELADIETTKITSSYESPAAGVLR
KQVAEAGETLPVGALIGVLADAETPDVDIEAFIKNFHAENPQDAAATEDANAGEPKPVTV
GEHTLNVRDVGTHTGTPIVLVHGFGGDISNWLLTQDALAADRRVIAFDLPGHGASSKNVG
TGTLAFLAGVVSELLKTLKIEKAHVVGHSLGGGIALTLLRDHPDQVASLNLLAPAGLGKD
VNSDFISAFVDSESSRDMKAVLQMLVHNKALVGRKMVDAVLRARRLDGARDALHVIAKAC
FPNGHQADDLRPVLAGAETPTQIFWGKEDEILSVSNASGLPDVIPVTVYEETGHLPQLER
ATDVNKAIAVFVKDPEAALSMARMDATA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacaccattacagccctcaccatgcccaagttcggtttggccatgacagaaggc
aaactggcatcatggacggtgccagttgaccagagcgtgcagcagggtgatgaactggcg
gatattgaaaccaccaaaattaccagcagttatgaaagccccgccgcaggtgtgttgcgc
aaacaggtggcagaggcgggggaaaccctgcccgtgggcgcactgattggcgtgctggct
gatgccgaaacgcccgatgtggatattgaagcctttatcaagaactttcatgccgaaaac
ccgcaggatgccgccgccacggaggatgccaacgccggagaacccaagccggtaacggtg
ggggaacacacgctgaatgtgcgtgatgtgggcacacatacgggcacgcccattgtgctg
gtgcacggttttggcggagatattagcaactggctgctcacgcaggatgctctggccgca
gacaggcgcgtgattgcgtttgacctgccggggcatggggcttcttccaaaaacgtgggc
acaggcacgctggcgtttttggccggcgtggtgagcgaattgctgaaaaccctgaaaata
gaaaaagcccatgtggtgggccattctctgggtggcggcattgcgctgaccctgctgcga
gaccaccccgatcaggttgccagcctgaaccttctggcccccgccgggttgggcaaggat
gtgaattcagatttcatcagcgcgtttgtggatagtgaaagcagccgcgatatgaaagct
gttttgcaaatgctggtgcataacaaagcccttgtgggccggaagatggtggatgccgtg
ctgcgtgcccgccggttggatggcgcgcgtgatgccctgcacgttattgccaaggcgtgc
ttccccaacgggcatcaggcggatgatttgcgcccggtcttggccggggcggaaacaccc
acccagattttctggggtaaggaagatgaaattctttctgtttccaacgcatccggcctg
ccagatgtcattcccgtaacggtgtatgaagaaacaggccatctgccgcagcttgaacgc
gcaacagatgttaacaaagccattgccgtgtttgtaaaagaccccgaagccgcgctgagc
atggcccggatggacgctacagcctaa

DBGET integrated database retrieval system