KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_06700Help
Entry
APA42C_06700      CDS       T01818                                 

Definition
acetylornithine deacetylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apw01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:apw00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
693837..695012
Genome map
AA seq 391 aa AA seqDB search
MADAAQVSIPANLALTDPVGVAQALIRLPSVSPDPGASQYLLAAMLERLGFEVIHLPFGE
GAERTPNFFARLGTGSPHICYAGHTDVVPPGNEADWSHPPYAADIVDGVLYGRGACDMKG
GIAAFVSAVARHVAAGPGKGSISFLITGDEEGPATYGTVKVLEWMAQHNQIPDYCLVGEP
TNPKVLGEMVKVGRRGSLNAHIVVEGTQGHVAYPHRADNPVHRLLAVLEALRATPLDNGT
EYFEPSSLQVTSVDVGNGATNVIPARAEARLNIRFNDLHTGAALKGWVETVCRQHAPRSR
VEIKISGESFLTSPTQETTALVEAIKQVTGRTPKLDTGGGTSDARFISRYCAVSEFGLVG
ASIHKVDEHTDVADLEMLTRIYQTFLEGAQA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgcagcgcaggtgagtattccggccaatctggcactgacagatccggttgga
gtggcgcaggcgcttatccgtctgccttctgtctcgccagatcccggggcatcacagtat
ctgcttgcagccatgctggagcgcctggggtttgaggtcatacaccttccgtttggcgag
ggtgcagagcgcacgcccaatttctttgcccgtctgggcacgggcagcccccatatctgt
tacgctggccataccgatgtggtgccgccggggaacgaggccgattggtctcatccccct
tatgcggcggatattgtggatggcgtgctgtatggccgtggcgcgtgtgacatgaagggc
ggcattgcggcttttgtgtctgccgtggcgcgacatgtggcggccgggccgggcaaaggc
tccatcagttttctgatcacgggggatgaagaaggccccgccacctatggcacggtaaag
gtgctggaatggatggcgcagcacaatcagatcccggattactgcttggtaggtgaaccc
accaaccccaaggttttgggcgagatggtgaaggtgggccgccgtggcagcttaaacgcg
catattgtggtggaaggcacacagggccatgtggcctatccccaccgggcagataacccg
gtgcatcgcctgctggcagtgctggaagcgttgcgcgccacaccgctggataacggcacc
gagtattttgaaccttccagccttcaggtcaccagtgtggatgtaggcaatggagctacc
aatgttattcccgcacgggccgaagcccgcctgaacattcggtttaatgatctgcacaca
ggggccgcgttgaagggctgggtagaaaccgtttgccgccagcacgccccgcgttcacgc
gtggagatcaagataagtggcgaatctttcctgacgtcccccacgcaggaaaccacggcc
cttgtagaggctatcaagcaggttacgggccgcacgcccaagctggataccgggggcggt
acatcggatgcccgctttatcagccggtattgtgcggtttccgaattcgggctggtgggc
gcgagtattcataaagttgatgaacacacggatgttgcggatctggaaatgctgacacgg
atctatcagacttttctggaaggagcgcaggcatga

DBGET integrated database retrieval system