KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_07220Help
Entry
APA42C_07220      CDS       T01818                                 

Gene name
holC
Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:apw00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:apw00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:apw03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:apw03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:apw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(745568..746014)
Genome map
AA seq 148 aa AA seqDB search
MTQIGFYHLTRTSVTEALPKLLARTLASGQKAAVWCASKPMLDDLDKALWKVTTPTWLPH
GREGIACPDLQPIWLSMGEDTPNNARFLFLLENRSFPDLAAFERVFDLFDGHDEEAVAAA
RTRWSAAKAAGHELAYWRQEEKGWNRAR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgactcagattggtttttaccaccttacgcgcacaagcgtgaccgaggcgctgcccaaa
ctgttggcccgcacactggccagcgggcaaaaagctgctgtgtggtgcgccagcaaaccc
atgttggatgatctggataaagccctgtggaaagtgaccaccccaacatggctgcctcat
gggcgcgaaggcattgcctgtccggatctgcaacccatctggctgagcatgggggaagat
acccctaacaatgcgcgctttctgtttttgctggaaaaccgcagctttcccgatctggca
gcatttgaacgggtgtttgacctgtttgacggccatgatgaggaagccgttgccgccgcc
cgcacccgctggagcgccgccaaagctgctgggcatgaactggcttactggcggcaggaa
gaaaaaggctggaaccgcgcccggtaa

DBGET integrated database retrieval system