KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_07980Help
Entry
APA42C_07980      CDS       T01818                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:apw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834340..835068
Genome map
AA seq 242 aa AA seqDB search
MHPRGVIVTRPEPGLSETMAAVADTGWLPLASPALVVQRHTLRLPQKLPAAILLTSGQAV
SAAVVAAQQAKALDIPVYAVGDRTAQRARDAGFTHVKSADGDARALVALLQTHQQPECGS
LLLCSGAGQGVELAAWCRQAGFKVVRRVVYAAKPIQHINAQTCTAIQAAKVAVVLFFSAE
SAAGWLAALPEAEQKQLAAQASAVVISGRVAGVLRAAGWQNIRVADHVSAAAVMDALGTY
PA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgcgcggcgtgattgtcacgcgcccggaaccggggctgagtgaaacaatggca
gccgttgcagatacaggctggctgccattggcctcacctgcattggttgtgcagcggcat
acgttgcgcctgccgcaaaaattacccgcagccatattacttaccagtgggcaagctgtt
tctgctgcggttgtagcggcacagcaggccaaagcgctagatataccggtttatgcggta
ggggatcgcacagcccaacgggcgcgagatgccgggtttacgcacgttaaaagtgcggat
ggtgatgcccgtgcgcttgttgcgcttttacaaacccaccaacagccagaatgtggcagc
ctgttgctatgctctggggcagggcaaggcgtagagcttgcggcttggtgcaggcaggcg
gggtttaaggttgtgcgccgggttgtttatgcagccaaaccgatccagcatataaacgct
caaacatgcacagccattcaggctgccaaggtggcggtggttctgtttttttcagcagag
agtgccgctggctggttggccgctttgcctgaggcagaacagaagcagttagctgcgcag
gcaagtgcggtggtgatatctggccgtgtagccggtgtgctgcgtgcggccggttggcag
aacatacgtgttgcagaccatgtatccgccgcagcggttatggatgctttggggacgtat
cccgcataa

DBGET integrated database retrieval system