KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_07980Help
Entry
APA42C_07980      CDS       T01818                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APA42C_07980
Enzymes [BR:apw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     APA42C_07980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834340..835068
Genome map
AA seq 242 aa AA seqDB search
MHPRGVIVTRPEPGLSETMAAVADTGWLPLASPALVVQRHTLRLPQKLPAAILLTSGQAV
SAAVVAAQQAKALDIPVYAVGDRTAQRARDAGFTHVKSADGDARALVALLQTHQQPECGS
LLLCSGAGQGVELAAWCRQAGFKVVRRVVYAAKPIQHINAQTCTAIQAAKVAVVLFFSAE
SAAGWLAALPEAEQKQLAAQASAVVISGRVAGVLRAAGWQNIRVADHVSAAAVMDALGTY
PA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgcgcggcgtgattgtcacgcgcccggaaccggggctgagtgaaacaatggca
gccgttgcagatacaggctggctgccattggcctcacctgcattggttgtgcagcggcat
acgttgcgcctgccgcaaaaattacccgcagccatattacttaccagtgggcaagctgtt
tctgctgcggttgtagcggcacagcaggccaaagcgctagatataccggtttatgcggta
ggggatcgcacagcccaacgggcgcgagatgccgggtttacgcacgttaaaagtgcggat
ggtgatgcccgtgcgcttgttgcgcttttacaaacccaccaacagccagaatgtggcagc
ctgttgctatgctctggggcagggcaaggcgtagagcttgcggcttggtgcaggcaggcg
gggtttaaggttgtgcgccgggttgtttatgcagccaaaccgatccagcatataaacgct
caaacatgcacagccattcaggctgccaaggtggcggtggttctgtttttttcagcagag
agtgccgctggctggttggccgctttgcctgaggcagaacagaagcagttagctgcgcag
gcaagtgcggtggtgatatctggccgtgtagccggtgtgctgcgtgcggccggttggcag
aacatacgtgttgcagaccatgtatccgccgcagcggttatggatgctttggggacgtat
cccgcataa

DBGET integrated database retrieval system