KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_08030Help
Entry
APA42C_08030      CDS       T01818                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
838103..839530
Genome map
AA seq 475 aa AA seqDB search
MKRLIVSAVGAALLAYGGTVAYLQHFDHITAPELPASSPTLKDPVALAAFNALREARCDY
CHAEQRDLPFYFRVPVAKTLMEKDRANGLRHFRVEPVLDAFEQGTVPTEEQLSRIEEVIT
QNRMPPNLYLMMHWHAHLSNAEREAVLKWVQDTRRKNYNNTGAAEQFAAEPIRPVPESVE
ADPAKWTLGRKLFFDKSLSGDNTLNCASCHGLDTGGVDNLVTATGIGGQKGPINTPTVYD
AYFKMAQFWNARATTLAEQAAGPVMNPVEMGSHNWEEVANKLNANPEYAPLFQAAFGPDA
KVDEKTITTAIGEFEKTLATPNGAFDEYLKGKPDAISEQAKRGYERFKAIGCSGCHTGIG
VGGRGMEIMGLEGDYFKDRGGKLTDADQGRYAVTHEASDMNRFVVPNLRNIELTGPYFHD
GSVKTLDEAVRKMARYQTPDQNISDQDVADIVAFLKTLTGRYDGKLLTNSNPAAK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgattaatcgtgtcagcagtgggtgcagctctgctggcttatggtggaacagtc
gcttacctgcagcattttgaccatattacagcaccagaattaccagcatcttcccccacg
ctgaaagatcctgtggcactggcagcgtttaacgccctgcgtgaggcacggtgtgattac
tgccatgccgaacagcgtgatctgccattttacttccgtgtgccggttgccaaaacgctt
atggaaaaagaccgcgccaacgggctgcgtcatttccgtgtagagccggtgctggatgcg
tttgaacagggtacagtccctacggaagagcagctttcccgcattgaggaagtgattacg
caaaaccgtatgccgccaaacctgtatctgatgatgcactggcacgcccatctgtctaac
gcagagcgtgaagccgtgttgaaatgggtgcaggatacgcgccgcaaaaactacaacaac
accggtgcggcagagcagtttgcagcagagcctattcgccctgtgccagaaagcgtggaa
gcagacccggctaaatggacgctggggcgcaagctgttctttgataagagcctgtcgggc
gataacacgcttaactgcgcaagctgccacgggctggataccggcggggtggataatctg
gttacagccaccggtattggtgggcagaaaggccccatcaacacgcctacagtgtatgat
gcctacttcaagatggcgcagttctggaatgcccgtgccaccacgctggcagaacaggcc
gctggccctgtgatgaacccggtggaaatgggttctcataactgggaggaagtggccaac
aagctgaatgccaacccggaatacgcaccgctgttccaggctgcatttggcccagatgcc
aaggttgatgaaaaaaccattaccacggctattggcgagtttgaaaaaacgctggctacg
ccaaatggcgcttttgatgaatacctcaaaggcaagccggatgccattagtgagcaggcc
aaacgcgggtatgaacgctttaaggccattggttgttcaggttgccataccggcattggt
gtgggtggacgcggcatggaaatcatgggtcttgaaggcgattactttaaagaccgtggt
ggcaagctgacggacgctgatcaaggccgttatgcggtaacgcatgaagcgagtgacatg
aaccgctttgtggtgcccaacctgcgtaatattgagctgacaggcccatacttccacgat
ggcagcgtaaaaacgctggatgaggctgtgcgcaaaatggcccgttaccaaaccccggat
cagaacatctctgatcaggatgtggcggacattgtggccttcctgaaaacgctgacaggg
cgttacgatggcaagttgctgaccaacagcaatccggccgccaaatag

DBGET integrated database retrieval system