KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_11890Help
Entry
APA42C_11890      CDS       T01818                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw01100  Metabolic pathways
apw01120  Microbial metabolism in diverse environments
apw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:apw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    APA42C_11890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C1
Motif
Other DBs
NCBI-ProteinID: BAI17624
Position
1247241..1247759
Genome map
AA seq 172 aa AA seqDB search
MDGRFLNRIAVSAVLSAAVLATCVFAARSTVPDTAPARPAFSLPGLEPVPIAPLMAQANV
QRGGATVRQVCAQCHALAGGAAENAGPPLAGVAGRGVASCTGYTYSAALRQHAGQHWTDQ
MLADWLMAPARFAPGTRMSLTGIPDPAQRADVIAFLHTLGGQAAPAQAGCTP
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggatggcaggtttctgaacagaatagcggtttccgccgtgcttagtgcggcagtgctg
gcaacatgtgtgtttgctgcacgcagcaccgtgccagatacagcccctgcccgccctgct
ttttctttgccggggttggagcccgtacctattgctccgttaatggcgcaggccaatgtg
cagcgtggtggtgcaaccgtcaggcaggtttgcgcgcagtgccacgccttggctggtggg
gccgcggaaaacgccgggccgccgctagccggtgttgctgggcgtggtgtggcatcatgc
actggctacacctattctgcggcgttacggcagcatgcaggccagcattggacagaccag
atgctagcggattggcttatggcccctgcccgctttgcacccggcacacgtatgtctctc
actggtataccagatcccgcccaacgggcggatgttattgcatttcttcacactctcggc
gggcaggctgcgcccgcacaggcaggatgcacaccatga

DBGET integrated database retrieval system