KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_17360Help
Entry
APA42C_17360      CDS       T01818                                 

Definition
(GenBank) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw00250  Alanine, aspartate and glutamate metabolism
apw01100  Metabolic pathways
apw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apw00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APA42C_17360
Enzymes [BR:apw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     APA42C_17360
Peptidases [BR:apw01002]
 Cysteine Peptidases
  Family C44
   APA42C_17360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF1059
Motif
Other DBs
NCBI-ProteinID: BAI18086
Position
1783291..1785051
Genome map
AA seq 586 aa AA seqDB search
MCGIGGLIYTPGTQPCSESVLERMAQALGHRGPNGVHIARLGRADMVHTRLAIIDLEGGD
QPLTSGDGTLVANGEIYNDPQIRRQIGPEHFQTGSDCESPLLLWERNGCTYTRGLRGMYA
IGLYDKAQQELLLSRDPFGIKPLYFTEFSGGIAFASEPAPLIASGLAPRAIAPAVRDELL
QLQFTTGWETIFPGIQRVMPGETLRINQGRILDRQRQSPIPAHAPFFTSEAEALNHLDAA
LMDSVHAHERSDVPFGLFLSGGIDSACLLTAMSRLPRTTPLRTWTAIFDAPGAADEAEAA
NALAQHARAKHETLRITADMVWQHLPAIVACMDDPVADYAIIPTWFLAQKAAQDVTVILS
GEGGDELFCGYGRYRSASRPWWKGKRRMWRRGIFDNMNILRQHPAHWRDGIAAAEMAAAD
AATPLSRLQAVDIAEWLPNDLLIKLDRCLMAHGLEGRTPLLDPVVAQTAWSLPDSMRLRD
GKGKWLLRKWLQQHNSAARPFAPKQGFTVPIGIWIRQQGAHLGDLVAQQECIAEIARPDR
VKALFRAADNRRTGAAAWALLFYALWHRTHIRNLPPEGDVFSALSQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcattggggggctgatttatacgcccggcacgcagccatgttccgaatcggtt
ctggaacgtatggcgcaggccttgggccatcgtggccccaatggtgtgcatattgcccgg
ttgggccgtgccgatatggtgcatacacgccttgccattattgatctggaaggtggagac
caacccttaaccagtggcgatggcacgcttgttgccaatggtgagatctataacgacccg
caaattcgccgacagatcgggccagagcatttccagaccggaagtgattgtgaatctccc
ctgcttttgtgggagcgtaacggctgcacctatacccgcgggctgcgcggcatgtatgcc
attggcctgtatgataaagcccaacaggaacttttgctctcgcgcgatccgtttgggatc
aaacctctttattttaccgaattttcaggcggcattgcctttgcatccgaacccgcgcct
ttaatcgcctctggtcttgccccccgcgccattgcgcctgctgtgcgcgatgaactgctg
caactgcagttcaccacagggtgggaaacaatttttcccggtattcagcgcgtcatgccg
ggggaaaccctgcgcatcaaccaagggcgtattctggacaggcaacggcaatcccccatt
ccggcccacgctccttttttcacttctgaagctgaggccctgaaccatcttgatgctgcc
ttgatggacagcgtgcatgcgcatgaacgttctgatgtgccatttgggctgttcctttct
ggcggcatagatagtgcctgcctgttaacagccatgagccgcctgccccgcaccacgccc
ttgcgcacatggaccgccatttttgatgcccccggtgctgcggatgaagcagaagctgcc
aatgccttagcccaacatgcccgcgccaaacatgaaaccttgcgcattaccgcagatatg
gtgtggcagcacctgccagccattgtggcctgtatggatgatccggttgcagattacgcc
attattcccacatggtttttggcccaaaaagcagcacaggatgtaaccgttattctctct
ggcgaagggggagatgaactgttttgtggctatgggcgttatcgctctgccagccgcccg
tggtggaaaggcaagcggcgtatgtggcggcgcggtatttttgacaacatgaatattctg
cgccagcacccagcccattggcgggatggcatagccgctgcagaaatggccgctgcagat
gccgcaacgccactttcacgcctgcaagctgtagatattgcggaatggttgccaaatgat
ctgcttatcaagctggatcgatgcctgatggcacacgggctggaaggccgcacaccgttg
ctagaccccgttgtggcccaaacagcatggagcctgcccgattccatgcgcctgcgtgat
ggcaagggaaaatggcttttgcgcaaatggttgcagcaacacaattctgccgcacgcccc
tttgcccccaagcaaggctttaccgtaccgattggcatatggatcagacagcaaggtgct
catcttggtgacttggtggcgcagcaggaatgtattgcagaaattgcccgcccagaccgt
gtaaaagccctgtttcgcgcagcagataaccgcagaacgggtgcagccgcatgggcactt
ttattttatgctctgtggcatcgcacacatattcgcaatcttccgccagaaggcgatgtg
ttttctgccttaagccagtaa

DBGET integrated database retrieval system