KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_17360Help
Entry
APA42C_17360      CDS       T01818                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:apw00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1783291..1785051
Genome map
AA seq 586 aa AA seqDB search
MCGIGGLIYTPGTQPCSESVLERMAQALGHRGPNGVHIARLGRADMVHTRLAIIDLEGGD
QPLTSGDGTLVANGEIYNDPQIRRQIGPEHFQTGSDCESPLLLWERNGCTYTRGLRGMYA
IGLYDKAQQELLLSRDPFGIKPLYFTEFSGGIAFASEPAPLIASGLAPRAIAPAVRDELL
QLQFTTGWETIFPGIQRVMPGETLRINQGRILDRQRQSPIPAHAPFFTSEAEALNHLDAA
LMDSVHAHERSDVPFGLFLSGGIDSACLLTAMSRLPRTTPLRTWTAIFDAPGAADEAEAA
NALAQHARAKHETLRITADMVWQHLPAIVACMDDPVADYAIIPTWFLAQKAAQDVTVILS
GEGGDELFCGYGRYRSASRPWWKGKRRMWRRGIFDNMNILRQHPAHWRDGIAAAEMAAAD
AATPLSRLQAVDIAEWLPNDLLIKLDRCLMAHGLEGRTPLLDPVVAQTAWSLPDSMRLRD
GKGKWLLRKWLQQHNSAARPFAPKQGFTVPIGIWIRQQGAHLGDLVAQQECIAEIARPDR
VKALFRAADNRRTGAAAWALLFYALWHRTHIRNLPPEGDVFSALSQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcattggggggctgatttatacgcccggcacgcagccatgttccgaatcggtt
ctggaacgtatggcgcaggccttgggccatcgtggccccaatggtgtgcatattgcccgg
ttgggccgtgccgatatggtgcatacacgccttgccattattgatctggaaggtggagac
caacccttaaccagtggcgatggcacgcttgttgccaatggtgagatctataacgacccg
caaattcgccgacagatcgggccagagcatttccagaccggaagtgattgtgaatctccc
ctgcttttgtgggagcgtaacggctgcacctatacccgcgggctgcgcggcatgtatgcc
attggcctgtatgataaagcccaacaggaacttttgctctcgcgcgatccgtttgggatc
aaacctctttattttaccgaattttcaggcggcattgcctttgcatccgaacccgcgcct
ttaatcgcctctggtcttgccccccgcgccattgcgcctgctgtgcgcgatgaactgctg
caactgcagttcaccacagggtgggaaacaatttttcccggtattcagcgcgtcatgccg
ggggaaaccctgcgcatcaaccaagggcgtattctggacaggcaacggcaatcccccatt
ccggcccacgctccttttttcacttctgaagctgaggccctgaaccatcttgatgctgcc
ttgatggacagcgtgcatgcgcatgaacgttctgatgtgccatttgggctgttcctttct
ggcggcatagatagtgcctgcctgttaacagccatgagccgcctgccccgcaccacgccc
ttgcgcacatggaccgccatttttgatgcccccggtgctgcggatgaagcagaagctgcc
aatgccttagcccaacatgcccgcgccaaacatgaaaccttgcgcattaccgcagatatg
gtgtggcagcacctgccagccattgtggcctgtatggatgatccggttgcagattacgcc
attattcccacatggtttttggcccaaaaagcagcacaggatgtaaccgttattctctct
ggcgaagggggagatgaactgttttgtggctatgggcgttatcgctctgccagccgcccg
tggtggaaaggcaagcggcgtatgtggcggcgcggtatttttgacaacatgaatattctg
cgccagcacccagcccattggcgggatggcatagccgctgcagaaatggccgctgcagat
gccgcaacgccactttcacgcctgcaagctgtagatattgcggaatggttgccaaatgat
ctgcttatcaagctggatcgatgcctgatggcacacgggctggaaggccgcacaccgttg
ctagaccccgttgtggcccaaacagcatggagcctgcccgattccatgcgcctgcgtgat
ggcaagggaaaatggcttttgcgcaaatggttgcagcaacacaattctgccgcacgcccc
tttgcccccaagcaaggctttaccgtaccgattggcatatggatcagacagcaaggtgct
catcttggtgacttggtggcgcagcaggaatgtattgcagaaattgcccgcccagaccgt
gtaaaagccctgtttcgcgcagcagataaccgcagaacgggtgcagccgcatgggcactt
ttattttatgctctgtggcatcgcacacatattcgcaatcttccgccagaaggcgatgtg
ttttctgccttaagccagtaa

DBGET integrated database retrieval system