KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_18410Help
Entry
APA42C_18410      CDS       T01818                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:apw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1903386..1903997
Genome map
AA seq 203 aa AA seqDB search
MSVPPSDTSQRPTQAEAEQAVRTLLRWAGDNPDREGLHDTPARVARAYTEFFCGYEIDPA
ALLRRTFSEVEGYDEIVLLRDIRFESHCEHHLAPIIGRAHVAYLPRQRVVGISKLARVVD
AYAKRLQIQERLTAQIANTINDELEPHGVAVIIESSHECMTTRGVHKPGVSMVTSTMLGV
FRENSDTRRELMAMLNRPAACEF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgcctccgtctgatacatctcaacgcccaacacaagccgaagcagaacaggct
gtacgcaccctgctacgctgggctggcgataacccggaccgtgaaggcctgcacgatact
cctgcccgtgttgcccgcgcttacaccgaatttttctgtgggtatgaaattgaccccgca
gccctgttacgccgcaccttttccgaagtggaagggtatgatgaaattgtgctgctgcgt
gatatccgctttgaaagccattgtgagcatcatctggcccccattatcgggcgtgcgcat
gttgcctatctgccgcgccagcgcgttgtaggcatttccaaactggcgcgtgtggtggat
gcctacgccaagcgcctgcaaattcaggaacggctcacggcccagattgccaacaccatc
aatgatgaactggaaccgcatggggttgccgttattattgaatcttcccacgaatgcatg
acaacacgcggcgtgcataaacccggtgtttccatggtcaccagcactatgctgggcgtt
tttcgggaaaattcagacacacggcgcgaactgatggcaatgctcaaccgccctgccgcc
tgcgaattctaa

DBGET integrated database retrieval system